KEGG   Bacillus subtilis subsp. subtilis 168: BSU40250
Entry
BSU40250          CDS       T00010                                 

Symbol
yycR
Name
(RefSeq) zinc-type alcohol dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00625  Chloroalkane and chloroalkene degradation
bsu00680  Methane metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BSU40250 (yycR)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSU40250 (yycR)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     BSU40250 (yycR)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C FAD_binding_3 PALP FAD_binding_2 ADH_N_assoc Pyr_redox_3 FAD_oxidored 2-Hacid_dh_C YtfJ_HI0045
Other DBs
NCBI-GeneID: 937754
NCBI-ProteinID: NP_391905
Pasteur: BG11471
BSORF: BG11471
UniProt: Q45604 A0A6M4JQY0
Position
complement(4135798..4137024)
AA seq 408 aa
MGGMALTGNKAVVYKGKGTVAVEDIGYPELILRDGPGVPKANVNRKCEHGVILKVITTNI
CGSDQHMVRGRTTAPEGLVLGHEITGEVIETGRDVEFIKKGDIVSVPFNIACGRCVMCKT
QKTHVCLNVNPDRPGSAYGYVDMGGWVGGQSEYVMVPYADFQLLVFPDKEQALEKILDLT
MLSDIFPTGFHGAYTAGVQTGSTVYIAGAGPVGLAAAHSAQLLGASTVIVGDLNEDRLAQ
ARSFGCETVNVQKHDRLGEQIEQILGEPTVDAAVDCVGFEASGHGNQGEAPAAVLNSIMD
VTQVGGSLGIPGLYVTEDPGAKDADAKTGSLKIRFGLGWAKAHTFVTGQTPAMTYNRNLM
KAILSGRAQIAKAVNATVISLDDAPKGYSDFDKGAAKKFVIDPHGTLK
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgggaggaatggcgttgacaggaaacaaagcggttgtgtacaaaggcaaagggactgta
gcggtggaggatatcggttatccggagttaatcttgagggacgggcccggcgtcccgaag
gcgaatgtgaatcgaaaatgtgagcatggggttattctcaaagtcattacaaccaacatt
tgcggaagcgaccagcatatggtcagaggccgcacaacggcgccagaaggcttggtgctc
gggcatgaaattacgggagaagtcattgaaacggggcgtgatgttgaatttatcaaaaaa
ggagatatcgtatccgttcctttcaatattgcctgcggacgctgtgtgatgtgcaaaacg
cagaaaacgcatgtgtgcctgaatgtcaatccggaccggccgggatcggcttacggctac
gtcgatatgggcggctgggtcggcggccagtctgaatatgtcatggtgccatacgctgat
tttcagcttttggtattccctgataaagaacaggcgctagaaaagattctcgatttgacc
atgctgtccgacatttttccgaccggcttccatggagcttatacagcgggcgtgcaaaca
ggttcaaccgtttatatcgctggagcgggtcctgtcggcttggcagctgcacactccgct
cagctcctaggcgcctctaccgtgattgtcggcgatctgaacgaagacaggctggcacag
gccagaagcttcggctgtgaaacggtcaacgtgcaaaaacacgaccgcctcggcgagcaa
attgaacaaatactaggtgaaccaaccgttgatgctgcagtggactgtgtcggctttgaa
gcatctgggcacggcaatcaaggagaagcgccagccgccgtgctgaactcaatcatggac
gtcacccaggtcggaggcagccttggcattccaggcttatacgtgaccgaagatcccggt
gcaaaggatgcggacgccaaaacaggctcattaaaaatccgcttcggactcggctgggcc
aaagcccacaccttcgtcaccggacaaacgcccgccatgacatacaaccgcaatttgatg
aaagcgatcctgagcggcagagcgcagatcgcaaaagccgtcaatgccaccgttatttct
ctggacgacgcgccaaaaggctacagcgacttcgacaaaggcgcagccaaaaaattcgtc
atcgacccgcatgggacattgaagtaa

DBGET integrated database retrieval system