KEGG   Bacillus subtilis subsp. subtilis 168: BSU40259
Entry
BSU40259          CDS       T00010                                 

Symbol
yyzG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2975
Other DBs
NCBI-GeneID: 8303112
NCBI-ProteinID: YP_003097801
UniProt: C0H3U0 A0A6M4JR33
Position
complement(4137087..4137257)
AA seq 56 aa
MQTNRVILLAVMICLVSAITVFLLNGCKVDFLDIGGTIIGCFLGIFVVVRIQKKQS
NT seq 171 nt   +upstreamnt  +downstreamnt
atgcagacaaatcgggttattcttctggcagttatgatctgcctggtttcggccattact
gtgttcttgttaaatggatgtaaagtcgacttcttagacatcggcggaaccattattgga
tgctttcttggcatatttgttgttgtaagaatacagaaaaaacagtcgtga

DBGET integrated database retrieval system