KEGG   Bacillus subtilis subsp. subtilis 168: BSU40260
Entry
BSU40260          CDS       T00010                                 

Symbol
yycQ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2651 DUF5989
Other DBs
NCBI-GeneID: 937733
NCBI-ProteinID: NP_391906
Pasteur: BG11470
BSORF: BG11470
UniProt: Q45605 A0A6M3ZHW3
Position
complement(4137362..4137610)
AA seq 82 aa
MGAIAVLFIVFGFPIVAGVFGIAGHFLFKRFWVAPLIVLITSLILLVTLASGNSSFIFWV
VMYTAIALVTSVATLFLRKFFE
NT seq 249 nt   +upstreamnt  +downstreamnt
atgggagccatcgccgttttatttatcgtttttggttttccgatcgtcgcaggtgtattt
ggtatagcgggtcattttttatttaaaagattttgggtggcaccgctcatcgttcttatc
acgagcttgatattgttagttacgttagcttcggggaatagctcattcatattttgggtt
gttatgtatacggcaattgcgttagtaacgagtgttgccacattatttctcaggaaattt
tttgagtga

DBGET integrated database retrieval system