KEGG   Bacillus subtilis subsp. subtilis 168: BSU40270
Entry
BSU40270          CDS       T00010                                 

Symbol
yycP
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PQQ_3 DUF5074 DUF2963 DUF3139
Other DBs
NCBI-GeneID: 937764
NCBI-ProteinID: NP_391907
Pasteur: BG11469
BSORF: BG11469
UniProt: Q45606 A0A6M4JR61
Position
complement(4137626..4138789)
AA seq 387 aa
MKKWMITIAMLILAGIALFVFISPLKSHKTVSQQDLRNPDFLDDKEVLLYFSSSADQDAF
GGGKSYALFISHDGTLSSFQMKGLELGSAKVHGDSVMLEDKNTIYTIKNGLRSHKRTYQH
TGDSAGFLQNTDGFYTLYNSGYDKKGDGYRSELYRQMDGEWKKDVIPYYIRASGFHDGAI
YALVPTDDGKGYQLLQIQADQKKLTYLSITEWQYREGASVESQLAVDDQAVYVMVRGQKA
HDLYQMVKINKKSGEVELHDIAEYKNDEQTIYSSMPFSFKNSFFPYDGNLYFIDGFGKVH
KIDAKTGKTSIVFTLSPDKMKAEFKEITQKGSSLYFFTYTYHKPAYIEQYSLKTGKKMKE
KEIGKVKDVVTPKSHLKLYDVEVMKRF
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgaaaaagtggatgattaccatcgccatgctgattctcgcaggaatcgcactatttgtc
ttcatttctcctctcaaaagccataaaaccgtgagtcagcaggatctcagaaatcccgat
ttcctggatgacaaagaagtcctgctgtatttctcatcctctgcggatcaagatgcattt
ggcggcgggaaaagctacgccctgtttatcagccatgacgggacgctgtcttcctttcag
atgaagggccttgagctgggctcagcaaaggttcacggtgacagcgtgatgctggaggac
aaaaacacgatttatacgatcaaaaacggcctgcgctcccataaaagaacctatcagcac
acaggcgacagcgcgggctttctgcaaaacacggacggcttttacaccttatacaactcc
ggctacgacaaaaagggagacggataccgctcagagctgtaccgccaaatggacggagag
tggaaaaaagacgtcatcccctactacatccgagcctccggtttccatgatggcgccatt
tacgcactcgtcccgacagatgacggaaaaggctatcagctccttcagattcaagcagat
cagaagaagcttacctatctcagcataacggaatggcagtaccgggaaggagcctcagtc
gaatcccaacttgccgtggacgaccaagctgtgtatgttatggttcgcggccaaaaagcc
cacgatctctatcaaatggtcaagatcaacaaaaaaagcggcgaagtagagctgcacgat
atcgccgaatacaaaaacgacgaacaaacgatatacagctccatgcccttcagctttaaa
aacagctttttcccttatgacgggaacctgtatttcattgacggcttcggaaaggtacac
aaaatcgatgccaagacaggaaaaacaagcatcgtcttcaccctttccccggacaaaatg
aaagccgaattcaaagaaatcacccaaaaaggcagcagcctctatttcttcacatacacg
tatcacaagcctgcctacattgaacagtacagcctgaaaaccggaaagaaaatgaaagaa
aaagagattgggaaggtaaaggatgtcgtgacgccgaagagtcatttgaagctgtatgat
gttgaggtgatgaagaggttttaa

DBGET integrated database retrieval system