KEGG   Bacillus subtilis subsp. subtilis 168: BSU40280
Entry
BSU40280          CDS       T00010                                 

Gene name
yycO
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peptidase_C92
Other DBs
NCBI-GeneID: 937766
NCBI-ProteinID: NP_391908
Pasteur: BG11468
BSORF: BG11468
UniProt: Q45607 A0A6M3ZIA7
Position
complement(4138800..4139537)
AA seq 245 aa
MKLKKRVSMFLVALTMCGGLFVTPAKAVKTTNYAEEIAALQPGTTPEEIMKSASQIAKQQ
HVKQDVILKQFYKEITADKAEGDRLAKESGMSIMGGSSGTKKLPTSAKGNIYYTNSYTAY
YNHGHVGMYSAADKIVESVPSDGVRQIAYNARDVEDNSIVQTVSVSSSQKTAAADWAVSK
VGDPYSFNFVNNRNTGHDGAKNCSKLLWSAFLLKAGIDIDSNGGLGVYPRDITSSSYTTT
IMTIY
NT seq 738 nt   +upstreamnt  +downstreamnt
atgaagttgaagaaacgagtgtcgatgtttttggtagcgctcacaatgtgcggcggcctg
tttgttactcccgccaaagccgtaaagaccacaaattatgctgaagaaatcgccgcactg
cagccaggcacgacaccggaagaaatcatgaaatctgccagccagattgccaaacagcag
cacgtaaagcaggacgttatcctaaaacagttctataaggagatcacggctgataaagca
gagggggaccggctcgccaaggaaagcggcatgtctatcatgggcggctcgtccggcacg
aaaaaactcccgacaagcgcgaaaggcaatatctattacacgaactcctacacagcctac
tacaatcacggccatgtcggcatgtactccgccgctgacaaaattgttgaatctgtcccg
agcgacggcgtcaggcagatcgcgtataatgccagagacgtggaagacaactccattgtg
caaaccgtcagcgtatcctcatctcaaaaaacagctgctgccgactgggcggtatcaaaa
gtcggcgacccatactcatttaacttcgtcaataacagaaataccggccatgacggcgcc
aaaaactgttcaaagctcctatggtctgcctttttgctgaaagcagggattgatatagac
agcaacggaggcttaggcgtgtatccgcgcgacatcactagttcttcttatacgacaacc
attatgaccatttactaa

DBGET integrated database retrieval system