KEGG   Bacillus subtilis subsp. subtilis 168: BSU40290
Entry
BSU40290          CDS       T00010                                 

Symbol
yycN
Name
(RefSeq) N-acetyltransferase YycN
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_3 Acetyltransf_10 Acetyltransf_7 FR47 Acetyltransf_4 Acetyltransf_15
Other DBs
NCBI-GeneID: 937725
NCBI-ProteinID: NP_391909
Pasteur: BG11467
BSORF: BG11467
UniProt: O32293 A0A6M4JR22
Structure
Position
complement(4139679..4140149)
AA seq 156 aa
MTIMLTPMQTEEFRSYLTYTTKHYAEEKVKAGTWLPEDAQLLSKQVFTDLLPRGLETPHH
HLWSLKLNEKDIVGWLWIHAEPEHPQQEAFIYDFGLYEPYRGKGYAKQALAALDQAARSM
GIRKLSLHVFAHNQTARKLYEQTGFQETDVVMSKKL
NT seq 471 nt   +upstreamnt  +downstreamnt
atgacaattatgctaacccctatgcagacagaagaatttcggtcttatctcacgtacaca
acaaagcattacgcggaagaaaaggtaaaagcgggaacatggctgcctgaagatgcccag
cttttgtctaagcaggtgtttactgatctgcttccgagagggctcgaaacaccccatcac
catttgtggagcctcaagctgaatgaaaaggatatcgttggctggctctggatacatgct
gaaccggagcatccgcagcaggaagcgtttatttatgatttcgggttatatgaaccgtat
cggggaaagggctacgcaaagcaagcattggcggcattagatcaagcggcacgcagtatg
ggaatccgcaagctgtcccttcatgtctttgcccataatcagacggctcgaaagctatat
gagcaaaccggatttcaagaaacagacgtagtgatgagcaagaagctttaa

DBGET integrated database retrieval system