KEGG   Bacillus subtilis subsp. subtilis 168: BSU40360
Entry
BSU40360          CDS       T00010                                 

Symbol
htrC
Name
(RefSeq) serine protease YyxA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Trypsin_2 PDZ_2 Trypsin PDZ_6 PDZ
Other DBs
NCBI-GeneID: 937779
NCBI-ProteinID: NP_391916
Pasteur: BG11054
BSORF: BG11054
UniProt: P39668 A0A6M4JR73
Position
complement(4147567..4148769)
AA seq 400 aa
MVDYEREEEHTTPEQPKRSKKGYFLSSLIGVIVGAVLMAFIMPYLSNEGLDTGALDQQQN
NNGRESIRTVNVSVNNAVTKIVSNMSPAVVGVVNIQKSDIWGESGEAGSGSGVIYKKNDH
SAYVVTNHHVIEGASQIEISLKDGSRVSADLVGSDQLMDLAVLRVKSDKIKAVADFGNSD
KVKSGEPVIAIGNPLGLEFAGSVTQGVISGTERAIPVDSNGDGQPDWNAEVLQTDAAINP
GNSGGALLNMDGKVIGINSMKIAESAVEGIGLSIPSKLVIPVIEDLERYGKVKRPFLGIE
MKSLSDIASYHWDETLKLPKNVTNGAVVMGVDAFSPAGKAGLKELDVITEFDGYKVNDIV
DLRKRLYQKKVGDRVKVKFYRGGKEKSVDIKLSSADQLGS
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggtggattacgaacgtgaggaagaacatactactcctgaacagccaaagagaagcaaa
aaaggatattttctttcgagtctgattggcgtgattgtcggtgccgtattaatggcgttt
atcatgccgtacctttcaaatgaagggctggatacaggcgccttagatcagcagcaaaac
aacaatggccgggaatcaatcaggacggtgaatgtcagtgtcaacaatgccgtcaccaag
attgtcagcaatatgtcgcccgccgttgtcggtgttgtgaacatccaaaaatcagatatt
tggggagagagcggcgaggctgggagcggctctggcgtcatctataagaaaaatgaccat
tccgcttatgtcgtgaccaaccatcatgtcatcgaaggcgcttcccaaattgaaatcagc
ttgaaagacggctcacgtgtatcagctgatcttgtcggcagcgaccagctgatggacctt
gccgttttacgggtgaaaagcgataagattaaagcagtcgctgatttcggaaattcagat
aaagtgaagtctggggagccggttattgcgatcgggaacccgttaggccttgagtttgca
ggctctgtcacacaaggcgtcatctcgggtacggagagggcgatcccagtagattcaaac
ggtgatggacagcctgactggaacgctgaagtcctgcaaacagatgcggccattaaccct
gggaacagcggcggcgctttgttaaatatggatgggaaggtcattggcatcaattcaatg
aaaattgccgagtcagcggttgaagggattggcctgtccattccgtctaagctcgtgatc
cctgtgatagaggatttagagagatacggaaaggtcaaacgcccgttccttggcattgag
atgaaatcgctaagtgacatcgcaagctatcattgggatgaaacattaaagcttcctaag
aacgtcaccaatggagcggttgtgatgggtgtagacgccttttcacctgccggaaaagcg
gggctgaaggaactggatgtcatcacggaatttgacggatacaaagtaaatgatattgtt
gacctgcgaaaacggctttatcagaaaaaagtcggtgaccgggtgaaggtgaagttttat
cgcggcggaaaagaaaaatctgttgatatcaagctgtcctccgcagaccaattaggcagt
taa

DBGET integrated database retrieval system