KEGG   Bacillus subtilis subsp. subtilis 168: BSU40440Help
Entry
BSU40440          CDS       T00010                                 

Gene name
dnaC
Definition
(RefSeq) replicative DNA helicase
  KO
K02314  replicative DNA helicase [EC:3.6.4.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03030  DNA replication
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BSU40440 (dnaC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU40440 (dnaC)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BSU40440 (dnaC)
DNA replication proteins [BR:bsu03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    BSU40440 (dnaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaB_C DnaB AAA_25 ATPase AAA Ribosomal_L3
Motif
Other DBs
NCBI-GeneID: 937810
NCBI-ProteinID: NP_391924
Pasteur: BG10004
BSORF: BG10004
UniProt: P37469
Position
complement(4157471..4158835)
Genome map
AA seq 454 aa AA seqDB search
MTDLLNDRLPPQNIEAEQAVLGAIFLQPSALTLASEVLIPDDFYRMSHQKIYNAMLVLGD
RGEPVDLVTVTSELANTDLLEEVGGISYLTDIANSVPTAANIEYYAKIVEEKSILRRLIR
TATTIAQDGYTREDEVEDLLSEAEKTIMEVAQRKNTSAFQNIKDVLVQTYDNIEQLHNRK
GDITGIPTGFTELDRMTAGFQRNDLIIVAARPSVGKTAFALNIAQNVATKTDESVAIFSL
EMGAEQLVMRMLCAEGNINAQNLRTGNLTEEDWGKLTMAMGSLSNSGIYIDDTPGIRVSE
IRAKCRRLKQESGLGMILIDYLQLIQGSGRSKDNRQQEVSEISRELKSIARELQVPVIAL
SQLSRGVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRDDYYDKETENKNIIEIIIAKQR
NGPVGTVSLAFVKEYNKFVNLERRFDDAGVPPGA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccttctgaatgaccggcttcctccgcaaaatatagaagccgaacaagccgtg
ttaggcgctatttttttacagccgtctgctttaacactggcttcagaagtattgattcca
gatgatttctatagaatgtcccaccaaaaaatctataatgcgatgctggtgctcggtgac
cgaggtgaaccggttgatctggtgacagttacatcagagcttgcgaacacagacctgctg
gaagaagtaggcggtatttcatatttgacagatatcgcaaactcggtgccgacagcggct
aacatagaatattacgcgaaaatcgttgaggaaaaatcgattcttcgccgattaatcaga
actgcgacaacgattgctcaagacgggtatacccgtgaggatgaggtcgaggatttactc
agtgaagcggaaaaaacgattatggaagtggcacagcgcaaaaacacgagtgccttccaa
aatattaaggacgtccttgtccagacctatgataatatcgaacagcttcacaatcgaaaa
ggtgatatcacgggaattccaacagggtttacggagcttgaccggatgactgcgggtttc
cagcgcaacgacttgatcattgtggctgcccgtccttcagtagggaaaacagcctttgcc
ctgaacatcgcacaaaacgtggcgacgaagaccgatgagagcgtagcgattttcagtctt
gagatgggtgccgagcagctcgttatgcgtatgctctgtgccgagggaaatatcaatgcc
cagaatctccgtacaggtaacctgaccgaagaggattggggcaagctgacgatggcaatg
ggaagcctatcgaacagcgggatttacatcgatgatacaccgggtattcgagtgagtgaa
atccgtgccaagtgccgccgcttgaagcaggaaagcgggctgggcatgattttgatcgat
tacctgcaattgattcagggaagcggtcgttcaaaggacaaccgtcagcaggaagtatct
gaaatttcccgtgaactgaagtcgattgcgagggagctgcaagtccctgttatcgcgctt
tctcagctttccaggggtgttgagcagcgtcaggataaacgtccgatgatgtctgatatc
cgggaatcaggaagtatcgagcaggacgcggatattgtcgcgttcctttatcgtgatgac
tactatgacaaagaaaccgagaataaaaatattatcgaaattattatcgccaaacagcgt
aacggcccggtaggaaccgtgtctcttgcgttcgtaaaagaatacaacaaattcgtcaac
ctggaacggcgttttgatgacgcaggcgttccgcccggcgcataa

DBGET integrated database retrieval system