KEGG   Bacillus subtilis subsp. subtilis 168: BSU40450Help
Entry
BSU40450          CDS       T00010                                 

Gene name
yycD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2188 Lipoprotein_Ltp
Motif
Other DBs
NCBI-GeneID: 937781
NCBI-ProteinID: NP_391925
Pasteur: BG10005
BSORF: BG10005
UniProt: P37480
Position
4159005..4159205
Genome map
AA seq 66 aa AA seqDB search
MIKKYAITPNVDADGWFIEVENVAPTALYTSKDAAIEKAKQVAKENSPSKLVIYDQFKNV
EEEHSF
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgataaagaaatatgcgattacacctaatgttgatgcggacggctggtttattgaggtg
gagaatgtagcgccgacagctttgtatacgtctaaagacgccgctattgaaaaggccaaa
caggtggctaaggaaaacagtccgtctaagcttgtaatttatgaccagtttaaaaatgtg
gaagaagaacactcattttaa

DBGET integrated database retrieval system