KEGG   Bacillus subtilis subsp. subtilis 168: BSU40530Help
Entry
BSU40530          CDS       T00010                                 

Gene name
cotF
Definition
(RefSeq) spore coat protein F
  KO
K06329  spore coat protein F
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU40530 (cotF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Coat_F DUF2383
Motif
Other DBs
NCBI-GeneID: 936671
NCBI-ProteinID: NP_391933
Pasteur: BG10012
BSORF: BG10012
UniProt: P23261
Position
4167110..4167592
Genome map
AA seq 160 aa AA seqDB search
MDERRTLAWHETLEMHELVAFQSNGLIKLKKMIREVKDPQLRQLYNVSIQGVEQNLRELL
PFFPQAPHREDEEEERADNPFYSGDLLGFAKTSVRSYAIAITETATPQLRNVLVKQLNAA
IQLHAQVYRYMYQHGYYPSYNLSELLKNDVRNANRAISMK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggatgaacgcagaacattggcttggcatgaaacattagaaatgcacgagctggttgct
tttcaatcaaacggactcattaaactgaagaaaatgataagagaagtaaaagaccctcag
ctcagacagctttataacgtgtctattcagggtgttgagcaaaatttgagagagcttctt
ccgttctttccacaggctccgcacagagaggatgaggaagaagaacgcgcagataaccca
ttttacagcggtgacctgctcggttttgccaaaacatctgtccgcagctatgccatcgca
attacagaaacagcaacacctcaattaagaaacgtactggtcaaacagctgaatgctgcc
atccagctgcacgcccaagtttatcgatacatgtatcagcatggatattatccgtcttac
aacctttctgaactgttgaaaaacgatgtcagaaacgccaacagagccatttcaatgaaa
taa

DBGET integrated database retrieval system