KEGG   Bacillus subtilis subsp. subtilis 168: BSU40560Help
Entry
BSU40560          CDS       T00010                                 

Gene name
yybP
Definition
(RefSeq) lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3829 Mt_ATP-synt_B ArAE_2_N Rad9 EF-hand_13 Prominin PMC2NT LMBR1
Motif
Other DBs
NCBI-GeneID: 937851
NCBI-ProteinID: NP_391936
Pasteur: BG10015
BSORF: BG10015
UniProt: P37488
Position
complement(4169166..4169612)
Genome map
AA seq 148 aa AA seqDB search
MKIILTVLAGVGLLSAGGCGMLDQVNDGLNYTSEAAGYVEKVKTFAEEAPELAEKAVNDT
EAKEKLEAQLESIQKAAADFNELTPPDAAAEIHRTIQEHNETLQKSAEDVLKQAEEGKVS
LKELEQSDLVQNAKQITDVMGQIEKLGE
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcattttgacagtacttgccggagtgggacttttgagtgcaggcggatgcggc
atgcttgatcaggtgaacgacggattgaactatacgagtgaagcagctggttatgtggag
aaggtgaagacatttgcagaggaagcgcctgaattggctgagaaagctgtaaatgacacc
gaggcgaaagaaaaacttgaagcgcagcttgagtcgattcagaaggctgccgctgatttt
aatgaattaacgccgcctgatgccgcagcggagattcatcgaaccattcaggagcataac
gaaaccttgcagaaaagcgctgaagatgtgttgaaacaagccgaggaaggcaaggtatcg
cttaaagaattggagcagtcagacctggtccaaaacgcaaagcaaattactgatgtgatg
ggacaaattgagaagctgggtgaataa

DBGET integrated database retrieval system