KEGG   Bacillus subtilis subsp. subtilis 168: BSU40570
Entry
BSU40570          CDS       T00010                                 
Symbol
yybO
Name
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1 OATP BT1 MFS_4
Other DBs
NCBI-GeneID: 937836
NCBI-ProteinID: NP_391937
Pasteur: BG10016
UniProt: P37489 A0A6M4JR54
Position
4170045..4171352
AA seq 435 aa
MTEEVFIMSQERVKRPGHTRWYISSLLSGIIILNYFDRVAISVAAPAIQDSFHLTATELG
IVFSIYTYSYTLMQLPVGSLLDRFGVAWVTRVGMTIWSFLTILLAFLQGKLLLYLFRFLI
GLTSASAFPAASKATALWFPPSERGLANSLFDSAAKFSNVIGAPLVAFLVTTFDWRVAFL
TIGCINVLFTIFFWQYYEQPERHKRISKSELNYIQKHNAITTEQIPYKTGPLLKKLFTNR
KVWGLMIGFTGYGYTFNLLLTWLPTFFKHTYGMDLMSSGLFTAVPWLISTISGIAVGGWL
VDYFIKKGYPNTKVYRTVIIVGMSFGFFFLGSILTNNITVAIICISIGLAGISATAPVGW
SISAELAPIGSVSMLSSMVNLANNLFGGIIAASLTGYLFDVTGSFTLSFLVAGFVLLLGL
VFYVFVLGDVKRIKL
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgacagaggaggttttcatcatgagtcaagagcgcgtgaaacggcctgggcataccaga
tggtacatatcttcgttacttagcggcattattattcttaattattttgaccgagtggcc
atctcggtagcggcccctgcgatacaagattcgtttcaccttactgcaactgaactcggc
atcgtgttttccatttacacctattcctatacactgatgcagctgcctgtcggaagtttg
ctggaccgttttggggtcgcatgggtcacgagggttggaatgacaatatggagcttttta
acgatccttcttgcttttttgcaaggaaaattgctgttgtatctgttccggtttctcatt
gggctgacgagcgcctctgcgttccctgctgcctctaaagcaaccgctctctggtttcct
ccaagtgagcggggattggcaaactcactgttcgattcggccgccaagttttcaaatgta
atcggcgcgccattggtcgcctttcttgtcacaacatttgactggcgtgtcgcttttttg
acgattggatgcatcaatgtgctgtttacgatctttttctggcagtattatgaacagcct
gaacggcacaaacgcatttctaaaagtgaactaaactatattcaaaaacacaatgccatt
acaacagagcaaatcccttacaaaacgggcccgcttttaaaaaagcttttcaccaatcga
aaagtatggggcttaatgatcggatttacagggtacgggtatacattcaacctgctgctc
acctggcttccgactttctttaaacatacatacggtatggatctcatgtcgtccggttta
tttacggcagtgccgtggctgatctcaaccatttccggaattgccgtcggcggctggctc
gtcgattattttattaagaaaggctatcctaataccaaggtgtaccgaaccgtaatcata
gtcggaatgagctttggctttttctttttaggatccattctgacgaacaatattaccgta
gccattatttgcatttccatcggactcgccggaatttccgcaaccgctccggtcggctgg
tccatctccgcagaactcgcgccgatcggttccgtatccatgctgagctccatggtgaat
ctcgcaaacaacctgttcggaggcattattgctgcgtcactgacagggtatttgtttgat
gtgacaggctcctttaccctcagctttctggtagctggttttgtgctgttgctgggattg
gttttttatgtgtttgtattaggggatgtaaaacgaattaaactatag

DBGET integrated database retrieval system