KEGG   Bacillus subtilis subsp. subtilis 168: BSU40570Help
Entry
BSU40570          CDS       T00010                                 

Gene name
yybO
Definition
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 OATP BT1
Motif
Other DBs
NCBI-GeneID: 937836
NCBI-ProteinID: NP_391937
Pasteur: BG10016
BSORF: BG10016
UniProt: P37489
Position
4170045..4171352
Genome map
AA seq 435 aa AA seqDB search
MTEEVFIMSQERVKRPGHTRWYISSLLSGIIILNYFDRVAISVAAPAIQDSFHLTATELG
IVFSIYTYSYTLMQLPVGSLLDRFGVAWVTRVGMTIWSFLTILLAFLQGKLLLYLFRFLI
GLTSASAFPAASKATALWFPPSERGLANSLFDSAAKFSNVIGAPLVAFLVTTFDWRVAFL
TIGCINVLFTIFFWQYYEQPERHKRISKSELNYIQKHNAITTEQIPYKTGPLLKKLFTNR
KVWGLMIGFTGYGYTFNLLLTWLPTFFKHTYGMDLMSSGLFTAVPWLISTISGIAVGGWL
VDYFIKKGYPNTKVYRTVIIVGMSFGFFFLGSILTNNITVAIICISIGLAGISATAPVGW
SISAELAPIGSVSMLSSMVNLANNLFGGIIAASLTGYLFDVTGSFTLSFLVAGFVLLLGL
VFYVFVLGDVKRIKL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggaggttttcatcatgagtcaagagcgcgtgaaacggcctgggcataccaga
tggtacatatcttcgttacttagcggcattattattcttaattattttgaccgagtggcc
atctcggtagcggcccctgcgatacaagattcgtttcaccttactgcaactgaactcggc
atcgtgttttccatttacacctattcctatacactgatgcagctgcctgtcggaagtttg
ctggaccgttttggggtcgcatgggtcacgagggttggaatgacaatatggagcttttta
acgatccttcttgcttttttgcaaggaaaattgctgttgtatctgttccggtttctcatt
gggctgacgagcgcctctgcgttccctgctgcctctaaagcaaccgctctctggtttcct
ccaagtgagcggggattggcaaactcactgttcgattcggccgccaagttttcaaatgta
atcggcgcgccattggtcgcctttcttgtcacaacatttgactggcgtgtcgcttttttg
acgattggatgcatcaatgtgctgtttacgatctttttctggcagtattatgaacagcct
gaacggcacaaacgcatttctaaaagtgaactaaactatattcaaaaacacaatgccatt
acaacagagcaaatcccttacaaaacgggcccgcttttaaaaaagcttttcaccaatcga
aaagtatggggcttaatgatcggatttacagggtacgggtatacattcaacctgctgctc
acctggcttccgactttctttaaacatacatacggtatggatctcatgtcgtccggttta
tttacggcagtgccgtggctgatctcaaccatttccggaattgccgtcggcggctggctc
gtcgattattttattaagaaaggctatcctaataccaaggtgtaccgaaccgtaatcata
gtcggaatgagctttggctttttctttttaggatccattctgacgaacaatattaccgta
gccattatttgcatttccatcggactcgccggaatttccgcaaccgctccggtcggctgg
tccatctccgcagaactcgcgccgatcggttccgtatccatgctgagctccatggtgaat
ctcgcaaacaacctgttcggaggcattattgctgcgtcactgacagggtatttgtttgat
gtgacaggctcctttaccctcagctttctggtagctggttttgtgctgttgctgggattg
gttttttatgtgtttgtattaggggatgtaaaacgaattaaactatag

DBGET integrated database retrieval system