KEGG   Bacillus subtilis subsp. subtilis 168: BSU40580Help
Entry
BSU40580          CDS       T00010                                 

Gene name
yybN
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2712
Motif
Other DBs
NCBI-GeneID: 937850
NCBI-ProteinID: NP_391938
Pasteur: BG10017
BSORF: BG10017
UniProt: P37490
Position
4173114..4173551
Genome map
AA seq 145 aa AA seqDB search
MNKFLKSNFRFLLAAALGISLLASSNFIKASNDNYKFHLLVPYGYGNAYSNDAFRQTTHT
DNPWKVNLQKSAEGKGTIMTFWLINTGNSKIPKASKIHNVKQGSGAHYYHANSQGSHTYV
ALAVENNNYSASSYGIDGVWDEETW
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattcctgaagagcaatttccgtttccttcttgcggctgctttaggcatatca
ttacttgctagtagtaattttataaaagccagcaatgataactataaattccatttactt
gtaccttatggctatggtaatgcctattcaaatgatgcatttagacagaccactcataca
gataatccttggaaagtaaatttacagaaatcggcagaaggtaaaggtacaatcatgaca
ttttggttgattaacacagggaatagtaaaattccaaaagcttctaaaatacataacgta
aaacaaggaagcggagctcattattatcatgcaaatagccagggaagccatacatatgta
gccttagcagttgaaaacaacaattacagtgcaagttcttatggtatagatggtgtatgg
gatgaagaaacttggtaa

DBGET integrated database retrieval system