KEGG   Bacillus subtilis subsp. subtilis 168: BSU40590Help
Entry
BSU40590          CDS       T00010                                 

Gene name
yybM
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2705 TMEM132D_C ABC2_membrane_3
Motif
Other DBs
NCBI-GeneID: 937824
NCBI-ProteinID: NP_391939
Pasteur: BG10018
BSORF: BG10018
UniProt: P37491
Position
4173665..4174420
Genome map
AA seq 251 aa AA seqDB search
MESHIYRIIKNKLTIIIFTIIILIPCVDISLLLMTNTEYHPAYAFFLSGTSVGHASQMIL
LWFLPLYFLLLCADDSIQDYKTGYHYILISKVGRKKYCLEKIFTSFIISFLTMFLSLILN
FLLVQVFFFKGTFKNDLDQIKFPDNSLYTFSMAHPYIAIVLFSIICCIMSGFVGALGSSL
SLLFRDKKYAYPASFFIWFVLILKNKSLMFLFQPFTEYGYNVLLPILCLSIFIFLIIISS
IVLYEAKYNEN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtcatatttatcgcattatcaaaaataaattaactataataatatttactata
atcatattaattccttgtgttgatatatcactattgttaatgactaacacagaataccat
cctgcatatgcgtttttcctttctggcacttccgtagggcatgcttcacaaatgatccta
ttatggtttcttccgctttattttttgttactatgtgctgacgattctatacaagattat
aaaacaggatatcattacattcttataagcaaagttggcagaaaaaaatattgtttggaa
aaaatatttacctcttttatcatttcatttttgacaatgtttttgtcactaatattaaac
tttttattggttcaggttttcttttttaaaggtacatttaaaaatgacttagaccaaatt
aaattccctgataacagcctttatacttttagtatggcccatccttatatagcaattgtg
ttattttctattatttgttgtattatgtctggatttgttggagcacttggttcaagcctc
agtttactttttcgtgataagaagtatgcctacccagcaagtttttttatttggttcgta
cttatactaaaaaacaaatcattaatgtttttattccaaccgtttacagaatacggttat
aatgtacttctccctatcctatgtttgtctatctttatttttctaataataatttctagt
attgttttatatgaggcaaaatacaatgaaaattaa

DBGET integrated database retrieval system