KEGG   Bacillus subtilis subsp. subtilis 168: BSU40600Help
Entry
BSU40600          CDS       T00010                                 

Gene name
yybL
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_4
Motif
Other DBs
NCBI-GeneID: 936529
NCBI-ProteinID: NP_391940
Pasteur: BG10019
BSORF: BG10019
UniProt: P37492
Position
4174410..4175120
Genome map
AA seq 236 aa AA seqDB search
MKIKRLLLILCLLLFLVTLWFNQNHTYLGKNSIASLLYMNNSTFGYSSIFAYTLFYIVPF
LMLLSNFFHSENPYKVMRMVKRKNYYKSKIMEIGFVSLLFSSIHTVINITCTHIFFSKNL
LVEANFLSICLLNMISLVFFYLSVGIMFRLTYDLFNSVALAIFIVYIILDSLYFGVKLLL
PNGYWEPFRDLAIFTNMLNRYWSTSNLIIVYIRQIIIVFIFYLVGSSIFLNKDYKK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaaagactactattaattttatgtttactactatttttagttactttatgg
ttcaaccagaaccacacttatcttggaaagaattctatcgcgtcattactatatatgaat
aatagtacattcggatatagttcaatatttgcatataccttgttttatattgtcccgttt
cttatgttacttagtaacttttttcattcagaaaacccctacaaagtaatgaggatggtt
aagcgtaaaaattactacaagtctaaaattatggagattgggtttgtttctttacttttt
tcttcaatacatactgttattaatattacgtgtacacatattttctttagtaaaaacttg
ttggtcgaagcaaactttttatcaatttgtttattaaacatgattagtttagtgtttttc
tacttatcagtaggtattatgtttagacttacatacgatctgtttaattcagtagcatta
gcaatttttattgtgtatataattttagatagcttgtatttcggcgttaaattattactt
cctaatggatattgggaaccctttagagacttggctatattcacaaatatgctcaataga
tattggtcaacttcaaatcttataatagtttatattagacagataataatagtttttatt
ttttatttagttggatcttcaatttttttgaataaggattataaaaaatga

DBGET integrated database retrieval system