KEGG   Bacillus subtilis subsp. subtilis 168: BSU40620Help
Entry
BSU40620          CDS       T00010                                 

Gene name
yybJ
Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00254  ABC-2 type transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU40620 (yybJ)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254]
    BSU40620 (yybJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_22 AAA_23 AAA_24 Mg_chelatase PIF1 AAA Zeta_toxin NACHT
Motif
Other DBs
NCBI-GeneID: 937807
NCBI-ProteinID: NP_391942
Pasteur: BG10021
BSORF: BG10021
UniProt: P37494
Position
4175869..4176525
Genome map
AA seq 218 aa AA seqDB search
MIEVLNLTKKIKKTTVLDNISYTFEKGTIYGLFGSNGSGKTMLLRALSGLIVPTEGSITI
KGEQLHKDISFPKSVGLIIENMQLLPQYDAFTNLKILSKIKKIASDNDILDSISRVGLEN
FNSVKVSKFSLGMKQRLNIAQAIFEKPDILLLDEPTNAIDEKGVAFVHDILLQEKKRGAT
IIITSHHKEDIISLCDIALEMNHGRLETSEKVIYKKDS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgattgaggtattaaacctaacaaaaaaaattaaaaagactacagttttagataatatc
tcttatacatttgaaaaaggaacaatttatggactatttgggagtaatggttctggaaag
accatgctacttcgtgcattatccgggttaatagtccctactgaagggagtataactatt
aaaggtgaacaattacataaagatatctcttttcctaaaagtgtaggattaattatagaa
aatatgcagttacttcctcagtatgatgcttttactaaccttaaaattttgtcaaaaatt
aaaaagatcgcatcagataatgatatattagattctattagtagagttggtttggaaaat
tttaatagtgtaaaggttagtaaattctcgttaggaatgaaacaacgattaaatattgca
caggctatttttgaaaaacctgatatattgctacttgatgaaccaacaaatgcgattgat
gaaaaaggagttgcatttgttcatgacattcttttacaagagaaaaaaaggggagctacc
attattattactagtcatcacaaggaagatattatatctttatgtgacattgcattagaa
atgaatcatggacgtctagaaacttcagaaaaagtaatatataagaaagatagttag

DBGET integrated database retrieval system