KEGG   Bacillus subtilis subsp. subtilis 168: BSU40630Help
Entry
BSU40630          CDS       T00010                                 

Gene name
yybI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VCBS FG-GAP PliI
Motif
Other DBs
NCBI-GeneID: 937811
NCBI-ProteinID: NP_391943
Pasteur: BG10022
BSORF: BG10022
UniProt: P37495
Position
complement(4176900..4177688)
Genome map
AA seq 262 aa AA seqDB search
MNVYDIRMAPYWFYEGRGLVQHPYVFRQPVSSRAIIVSTRGDVTGDGVIDEVFLTGNQMP
GSPLWRNITLVIRDGRTHQEQRIQLQNNMGYNPSLFLGDMTGDKIEDVAVVMDTGGSGGA
IYAYVFAYLNRQFRRIFNSDVLNDELKYSVRYQNQYKASVISHQQNETYILDLTYKGREY
LNEIYNSQGVLKMPIEGWVNPLSGLYPVDFDRDGVYELLAYQRIAGRYNADSLGYVQTVL
KWNGQRFMFNRQTVTIFGSDLS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgtgtatgacatcagaatggctccttattggttttatgaaggcagaggacttgtt
caacatccatacgtatttcggcagcctgtctcctcacgtgcaatcattgtatctacccgc
ggcgatgtaacgggagacggcgttattgacgaggtctttctaactggaaatcaaatgccc
ggcagcccgttatggagaaatatcacattggtgatccgtgatggcagaacccatcaggag
cagcggattcagcttcaaaacaatatgggatacaatccgtcactttttctgggggatatg
acaggcgacaagattgaggatgtggcagtagtaatggacacagggggaagcggcggtgct
atttatgcatatgtgtttgcctatctaaacaggcagttccggcgaattttcaattcagat
gtattgaatgatgaattaaagtacagtgtgaggtatcaaaatcaatataaagcgagcgtt
atcagtcatcagcaaaacgaaacgtatatcctcgaccttacttacaagggcagggaatat
ttgaatgagatttataacagccaaggtgtgttaaaaatgccgatagaaggatgggtgaat
cctttatcgggcttgtatccggttgattttgacagagacggcgtatacgaattattggcg
taccagcggatagcgggaaggtataacgccgactcattgggatatgttcaaaccgtatta
aaatggaacgggcagaggtttatgtttaaccgtcagactgttacgatttttgggagtgac
ttatcttaa

DBGET integrated database retrieval system