KEGG   Bacillus subtilis subsp. subtilis 168: BSU40640Help
Entry
BSU40640          CDS       T00010                                 

Gene name
yybH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SnoaL_3 DUF4440 SnoaL_2 mCpol SnoaL_4
Motif
Other DBs
NCBI-GeneID: 937866
NCBI-ProteinID: NP_391944
Pasteur: BG10023
BSORF: BG10023
UniProt: P37496
Structure
PDB: 

Position
complement(4177756..4178145)
Genome map
AA seq 129 aa AA seqDB search
MEQQLKDIISACDLAIQNEDFDTLMNYYSEDAVLVVKPGMIARGKEEIKKAFITIANYFN
HHIVPTQGKMILLEAGDTVLVLSQTLLDSDKKDSEYAMERRATYVFKKNAQGEWLCVIDN
SYGTDLIGV
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
ttggaacagcaattgaaagacatcatctctgcgtgtgatttggcaatccaaaatgaagat
tttgatacactgatgaattattattcggaagatgccgttttagttgtgaagccgggcatg
atcgcgcgaggcaaggaagaaatcaaaaaagcgtttatcacgattgcgaactatttcaat
catcatattgtcccgacacaagggaaaatgatcctgttggaagcaggtgacacggtactc
gttctttctcagacactgcttgattcggataaaaaggactccgagtatgcgatggaaaga
agggcgacctatgtatttaaaaagaatgcgcaaggcgagtggctttgtgtaattgataat
tcatatggtacggatttaattggtgtgtaa

DBGET integrated database retrieval system