KEGG   Bacillus subtilis subsp. subtilis 168: BSU40650Help
Entry
BSU40650          CDS       T00010                                 

Gene name
yybG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pentapeptide Pentapeptide_4 Pentapeptide_3
Motif
Other DBs
NCBI-GeneID: 937852
NCBI-ProteinID: NP_391945
Pasteur: BG10024
BSORF: BG10024
UniProt: P37497
Position
4178291..4179130
Genome map
AA seq 279 aa AA seqDB search
MSAEVTLHDNIHYDLSADCQHCFGLCCVALPYAKSADFAFDKDGGTPCRNLQSNYQCSIH
KDLREKGFRGCSAYECFGAGQKVSQITYEGKDWRNSPETANQMFDVFPIMQQLHEMLWYL
HEALSIDIAKPIHSELRTTFEKIERLTRLSKERLLTLQVDEHRAEVNEWLLKTSELVRAQ
ARHPKLPKKVSRGSVLIGAKLKGLDLRGANLRGALLIAADLRNADLRMTDFIGADMRDAD
LSGADLTGSIFLTQAQVNAANGDSNTKLPLSVRTPAHWK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgcggaagtaacgttacatgacaatatacattatgatttaagtgcggattgccag
cactgttttggcctgtgctgtgtcgccttgccttatgcgaagtcggcagattttgctttt
gataaagacgggggcacgccttgccgcaacttacaatcaaactatcaatgttctatacat
aaagatctcagagaaaaaggatttcgaggctgctctgcatatgaatgctttggcgccggc
caaaaagtatcccaaatcacttatgagggaaaggattggcgaaacagccccgaaacggcc
aaccagatgtttgacgtttttcctatcatgcagcagctgcacgaaatgctctggtattta
catgaagctctttctatagatatagccaagccgattcattctgaactgagaaccactttc
gaaaaaatagaaaggctcaccagactcagcaaagaacgcttgctgacactgcaggtggac
gagcatcgagctgaggtcaatgaatggctgttaaaaacaagtgaactggtgcgtgcccaa
gcccgccatccaaaactcccgaaaaaggtcagccggggaagtgtcctgatcggcgcgaaa
ctgaaagggcttgatctgcgaggagcaaatctaagaggggcgctgctcatagccgccgat
ctgagaaatgccgatttgagaatgacagactttatcggtgcagatatgagagacgctgat
ctcagcggcgccgacctgaccgggagcatctttttgacacaggcacaggtgaacgccgcc
aacggcgattcgaatacaaagctgccgctgtctgtacgaacccctgcccattggaaataa

DBGET integrated database retrieval system