KEGG   Bacillus subtilis subsp. subtilis 168: BSU40660Help
Entry
BSU40660          CDS       T00010                                 

Gene name
yybF
Definition
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-GeneID: 937854
NCBI-ProteinID: NP_391946
Pasteur: BG10025
BSORF: BG10025
UniProt: P37498
Position
complement(4179163..4180377)
Genome map
AA seq 404 aa AA seqDB search
MTYIRKGTPVFRKITFAFFAAGFNTFAILYCVQPLMEEFTREFHVTPTAASLSLSVTTML
LAVSMLVFGSLSEVWGRKPIMGISMLAASVLCLASAFSPSFHTLLVLRTIQGVALAGLPS
IAMAYLGEEIEPGSLGSAMGLYISGNAIGAVFGRIVSGLLSEYLNWHMAMGTIGVISLIA
SVIFFINLPPSRHFTPRKLKLGKLGMSLIGHLRDRKLFSLFLIGFLLLGSNVALFNYIVY
VLLGPPYSLNKAFSSWIFIVMIVGIFSSSFIGRMVDRYGYPKILVMNIFIVIAGALFTIN
NMLAVKILGIALFTFGFFGGHSVASSWVGRRALHNKAQASSLYLFFYYAGSSVFGTIGGL
FWSGFHWLGVVGMITFMLLVALWLSGYLARSVKMPDKRNEKGLN
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacatacattcgaaaaggcacaccggtttttcgaaaaattacgtttgctttcttcgct
gcgggtttcaatacatttgcgattctatattgcgtacagccgctcatggaggaattcacg
cgggaatttcatgtaacgcctactgcggcgagtctttctttatctgttaccacaatgctg
ttagctgtgagcatgcttgtctttggttcattatccgaggtgtggggacgcaagcctatt
atgggtatttccatgctggccgcatcggttctctgtctggcatcggcctttagtccgagc
tttcatacactgctcgtattgagaaccattcaaggcgttgcgctcgcaggccttccgtcg
attgcgatggcttatcttggggaagaaattgaacccggaagtcttggatcagcgatgggg
ctatatatcagcggaaatgcaatcggcgccgttttcggaaggatcgtttccgggctcctg
agcgagtacttgaattggcatatggcgatggggacaattggtgtcattagtttgattgct
agtgttatattttttataaatttgccgccatccaggcattttacgccaagaaaattgaag
ctcgggaaattgggaatgtctctgatcggccacttgagggaccgtaaactattcagcttg
tttctcattggttttttgctgcttggaagcaatgttgccttgtttaattacattgtgtat
gtgctgttgggcccgccgtattcgcttaataaagcattttccagctggatctttattgtg
atgattgtaggcattttcagctcgtctttcattggaagaatggttgatcggtatggctat
ccgaaaatattggtgatgaatattttcatcgtcattgcaggtgcgttatttacgataaac
aatatgctggcagtgaaaattctggggattgccctctttacattcggttttttcggaggg
cattcagttgccagcagctgggtgggcaggagagcccttcacaacaaagcacaggcttca
tcgctgtatttgttcttttattacgccggttcaagtgttttcggaacaatcggagggcta
ttctggtctggttttcactggctgggcgtcgtcggtatgatcaccttcatgctgctggtt
gcgttatggctgtcgggatacttggcaagaagtgtgaaaatgccggataagaggaacgaa
aaaggattgaattga

DBGET integrated database retrieval system