KEGG   Bacillus subtilis subsp. subtilis 168: BSU40670Help
Entry
BSU40670          CDS       T00010                                 

Gene name
yybE
Definition
(RefSeq) HTH-type transcriptional regulator YybE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-GeneID: 937875
NCBI-ProteinID: NP_391947
Pasteur: BG10026
BSORF: BG10026
UniProt: P37499
Position
4180564..4181442
Genome map
AA seq 292 aa AA seqDB search
MEWEQLEYFQTLARMQHVTKAAKSLSITQPALSRSIARLENHLGVPLFDRQGRSISLNQY
GHIFLRRVQAMMKEYTEGKEEIQALLKPDQGVVSLGFLHTLGTTLVPDLIGSFQQEYPNI
SFQLKQNHSYWLLERLKSGDLDLCLLASIKPENPIQWIKLWSEELFVFVPNDHPLASRES
ITLNEIAGERFILLKKGYALRMTVDELFEKANIQPNIMFEGEEATTAAGFVAAGLGISIL
PDLKGLDQSKITKIRVSWPECQRVIGIAWIKGRFLSPVAETFKQYVISHFSE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttggaatgggaacaacttgaatattttcaaacactggcccggatgcagcacgtcacgaaa
gccgcaaaaagcctctccatcacacagcctgcactttcacgctctatcgccaggctggaa
aatcatttgggcgtcccgctatttgacaggcaaggacgatccatcagcttaaatcaatac
ggacacatttttttacgacgggttcaggcgatgatgaaggagtataccgaaggaaaagaa
gaaatccaagccttattaaagccagaccaaggcgtagtctctctcggttttttacataca
ttaggcaccacgctcgtgcccgatctcatcggctcctttcagcaggaataccccaacatt
tccttccagctgaagcaaaaccactcttattggctgcttgaacgattaaaatccggagat
ctggacctctgtctcctcgcttcgattaagcctgaaaatccgatccaatggatcaagctg
tggagtgaagaactctttgtatttgtgccaaatgatcacccattagccagtcgcgaaagc
attaccctgaatgagattgccggggagcgttttattttattgaaaaagggctatgcgctt
cggatgacggtcgatgagctgtttgagaaggccaatatacagccgaacattatgtttgaa
ggagaagaagcaactactgccgcaggttttgtggcagccggtctgggcatatctattctc
ccagacctgaaaggcttagaccaaagcaaaatcaccaaaatccgcgtcagctggccggaa
tgtcagcgtgtcataggaattgcctggataaaaggcaggtttttatcaccggttgctgag
acctttaaacaatatgtgatcagccatttttctgagtag

DBGET integrated database retrieval system