KEGG   Bacillus subtilis subsp. subtilis 168: BSU40680Help
Entry
BSU40680          CDS       T00010                                 

Gene name
yybD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_10 Acetyltransf_1 Acetyltransf_7 FR47 Acetyltransf_5 Acetyltransf_9
Motif
Other DBs
NCBI-GeneID: 938072
NCBI-ProteinID: NP_391948
Pasteur: BG10027
BSORF: BG10027
UniProt: P37500
Position
4181456..4181899
Genome map
AA seq 147 aa AA seqDB search
MNVKKITSEQDLHTAFEIRKAVFVEEQGCPISDEFDEFDTLHGDCQHILAYHQNVPVGTA
RVRIVGHTGKLERICILKSYRKFGLGKVIVDALERIVKEQGISAFKLHGQTQAAGFYEKL
GYRTASEEFMLDGIPHVLMTKQDDSAL
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcaaaaaaatcacgtcagaacaggatttacatacagcgtttgaaatcagaaag
gcagtatttgtagaggaacaaggctgtcccatttcggatgaattcgatgagttcgataca
ctccacggtgactgccagcacatcctggcttatcatcagaatgtacctgttggcactgca
cgtgtccgtatcgttggccacacggggaaactggaacgaatctgcattctgaagtcttac
cgcaaattcggtttgggaaaagtgatcgtcgatgcattagaacgtattgtaaaagaacaa
ggcatttctgccttcaaactgcacggccagacacaggcggcaggcttttatgaaaagctc
ggctatcggactgcatcagaagaatttatgctggacggcattccgcatgtgctgatgaca
aaacaagacgattctgcgctatag

DBGET integrated database retrieval system