KEGG   Bacillus subtilis subsp. subtilis 168: BSU40690
Entry
BSU40690          CDS       T00010                                 

Gene name
yybC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2798
Other DBs
NCBI-GeneID: 937862
NCBI-ProteinID: NP_391949
Pasteur: BG10028
BSORF: BG10028
UniProt: P37501
Position
4181982..4182461
AA seq 159 aa
MPANKKEGLIFGVMMCFGMVCVMSIYNAIINRAIYDFSLMTVFEMVIGFMIALLLDLLLV
GPLAKKIAFRMPFDKTKKIYVILAMSTCMVIGMVLCMSVFGLVTAVLANGLNGDSLFSAY
LMIVLKNFILAYPLQLLIMGPLVRGVFMKFVKPKLTAAI
NT seq 480 nt   +upstreamnt  +downstreamnt
atgccagcaaataaaaaagaaggccttatatttggcgtgatgatgtgctttggaatggtt
tgcgtcatgtcgatttacaatgccatcatcaaccgagccatctacgatttttcactgatg
accgtttttgaaatggtcatcggttttatgatcgccctcctgttagatttactgttagtg
ggccccctcgccaagaagattgcattccgcatgccgttcgacaagactaaaaaaatttat
gtcatccttgccatgtcaacttgtatggtgattggcatggtactttgtatgtctgtgttc
ggtttagtgacagcggttctagcaaatgggctgaacggggacagcctcttcagtgcttat
cttatgattgtgttgaaaaatttcatcctggcctatccgttgcaattactgattatgggc
ccattagtcagaggagttttcatgaaatttgtaaaaccaaagctcacagccgcaatttaa

DBGET integrated database retrieval system