KEGG   Bacillus subtilis subsp. subtilis 168: BSU40700Help
Entry
BSU40700          CDS       T00010                                 

Gene name
yybB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B Lactamase_B_2 RMMBL
Motif
Other DBs
NCBI-GeneID: 937880
NCBI-ProteinID: NP_391950
Pasteur: BG10029
BSORF: BG10029
UniProt: P37502
Position
complement(4182636..4183298)
Genome map
AA seq 220 aa AA seqDB search
MNLRQLSEHVFQCEFELDVPLRIPVHTWFIKDGDDVYIVDTGIERFADAQIRAALAIGNP
KAILLTHGHSDHIGGASKWLERFDIPIFAHQKELKYINGEEPYPNKNEVENTGVAHIVQP
LTEQTLAHLPLKYYLTPGHSPGHVVYYHKIDRTLLTGDLFITSKEDLHPPIRRFSVDINE
NIDSGSIIDQIKPTLICSSHGEEILYNEELYKNYVVRYRD
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtgaatttgagacaactatcagaacatgtctttcaatgtgaatttgagcttgatgtgcct
cttcgtattccggttcatacctggtttatcaaagatggtgatgatgtttatattgttgat
acgggaatagaacgttttgctgatgctcaaattagggcagcgttagcgatcggcaatcca
aaagccattttgcttacccatggccacagtgatcatatcgggggtgcatcaaaatggtta
gagagatttgatattccgatttttgcgcaccagaaagaactaaagtacatcaatggggaa
gagccatatccgaacaaaaatgaagtggagaacacaggggtagcccatattgtacagccg
ctgacggagcaaacgcttgctcatctgcctctgaaatactatttaacacctggccattcg
ccggggcatgttgtgtattatcataaaatcgatcgtacgctattgacgggcgaccttttt
atcacaagtaaggaggatttacacccacctataagaagattcagtgttgatataaatgag
aacatcgacagcggctcaatcatagatcaaatcaaaccaacgctcatttgctcttcacat
ggcgaagaaatcctttataacgaagaattgtataaaaactatgtggtaaggtatagggat
taa

DBGET integrated database retrieval system