KEGG   Bacillus subtilis subsp. subtilis 168: BSU40710Help
Entry
BSU40710          CDS       T00010                                 

Gene name
yybA
Definition
(RefSeq) HTH-type transcriptional regulator YybA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2 HTH_24 TrmB HTH_11 HTH_Crp_2 HTH_36 GntR Fe_dep_repress DUF505 HTH_AsnC-type B-block_TFIIIC
Motif
Other DBs
NCBI-GeneID: 937872
NCBI-ProteinID: NP_391951
Pasteur: BG10030
BSORF: BG10030
UniProt: P37503
Position
complement(4183445..4183897)
Genome map
AA seq 150 aa AA seqDB search
MNDILREIGMIARALDSISNIEFKDLDLTRGQYLYLVRIYENPGIIQEKLAEMIKVDRTT
AARAIKKLEMQGFIQKLPDEQNKKIKKLFPTEKGKKVYPLLRREGEHSTEVALSGFTSEE
KETISALLHRVRKNIERDWEYVKKGNKRDY
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatattttgcgtgagatcggcatgatagcaagagcgttggattccataagcaac
atcgaatttaaagatttagacttaacaagagggcagtatctctatctcgtgcgtatatac
gaaaatccgggaattattcaagaaaaattggcggaaatgataaaagtggaccggacaacg
gccgcgcgggccattaagaagctggaaatgcagggatttattcaaaaactgccggatgag
caaaataaaaaaataaaaaaactgttcccgactgagaaagggaaaaaggtatatccattg
ttaagaagagaaggagaacattccacggaagtggccttgtccggttttacttcagaggaa
aaggaaaccatttctgcactccttcatagagtgaggaagaatatagaacgtgattgggaa
tatgtgaagaaggggaacaaaagggattattaa

DBGET integrated database retrieval system