KEGG   Bacillus subtilis subsp. subtilis 168: BSU40720Help
Entry
BSU40720          CDS       T00010                                 

Gene name
yyaT
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_10 Acetyltransf_1 Acetyltransf_7 Acetyltransf_5 FR47 Acetyltransf_9
Motif
Other DBs
NCBI-GeneID: 937874
NCBI-ProteinID: NP_391952
Pasteur: BG10031
BSORF: BG10031
UniProt: P37504
Position
4184017..4184463
Genome map
AA seq 148 aa AA seqDB search
MNIKRITTEADLHEALKIRRGVFIEEQHVSEADEFDEFDTLQEQCQHILVYHENQPVGTG
RARIVGHTAKLERICILKPYRKYGLGKIIVSGLEEIMKEKGLTSYKLHGQTQAAGFYQKL
GYQISSQEFMEDGIPHVLMTKEISRNIT
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaatataaaaagaataacaactgaagctgatttacatgaagctttaaagattagaaga
ggcgttttcattgaggagcaacatgtgtctgaagccgatgagttcgatgaatttgatacg
cttcaggaacaatgccagcatatcttggtatatcatgagaatcagcctgtcggcaccgga
cgcgcgcgcatcgttggccatacagcaaagctggaaagaatctgcatcctaaaaccttac
cgtaagtacggattggggaagatcatcgtaagcgggttagaggaaatcatgaaagaaaaa
ggactgacttcatataagctgcatggtcaaacacaagcggcaggcttttatcaaaaactg
ggctaccagatttcttcacaggaatttatggaggacggcatccctcacgtcttgatgaca
aaagaaatatcgcggaatataacatga

DBGET integrated database retrieval system