KEGG   Bacillus subtilis subsp. subtilis 168: BSU40730Help
Entry
BSU40730          CDS       T00010                                 

Gene name
yyaS
Definition
(RefSeq) hypothetical protein
  KO
K07149  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU40730 (yyaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YitT_membrane
Motif
Other DBs
NCBI-GeneID: 937921
NCBI-ProteinID: NP_391953
Pasteur: BG10032
BSORF: BG10032
UniProt: P37505
Position
4184460..4185065
Genome map
AA seq 201 aa AA seqDB search
MKYMYYGIGILILSLGISLTIQSGLGTSPFDALLVGLSKKIGLTVGSWEVLISVILLICN
AILTRKKPILLGLITAFITGIGIDLWLFVVKNTIYLNSLLSKLICFGIGLVLIGLGTAIY
LQTKFASTPIDHLTLIIRDLSKRTILFSRTLVYALFLVLAIIFKGPIGIGTLLTVCLGGM
LLHVFMPIVERHFLSKNRRGY
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatgtattacggaataggcatactcatattaagtttgggcatttccttaacc
atacaatcaggactgggcacatcacccttcgatgcccttttggttggtctgtcaaaaaaa
atcggtcttaccgtaggaagctgggaggtccttatttctgtgatcctcttaatctgcaac
gctatattaacgagaaaaaaacctattttgctgggcttgattacagcattcattactgga
ataggcattgacctatggttgtttgttgtaaaaaacaccatctatctaaactcgttgtta
agcaaactgatttgttttggaattggtttggtgctcatcggtcttggaacagccatctat
cttcagacgaaattcgcatcaacaccgatcgatcatttaacacttattatccgagatctc
tccaaaagaacaatattgttttcaaggacattggtatacgctcttttcttagtattagcc
atcatctttaaaggccctatcggcatcggaactcttttaacggtttgtttgggaggaatg
ctccttcacgtttttatgcctattgtggaaagacatttcttatcaaagaatagaagaggt
tattaa

DBGET integrated database retrieval system