KEGG   Bacillus subtilis subsp. subtilis 168: BSU40740Help
Entry
BSU40740          CDS       T00010                                 

Gene name
yyaR
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_9 Acetyltransf_CG Acetyltransf_3 Acetyltransf_13 PanZ
Motif
Other DBs
NCBI-GeneID: 937878
NCBI-ProteinID: NP_391954
Pasteur: BG10033
BSORF: BG10033
UniProt: P37506
Position
complement(4185160..4185681)
Genome map
AA seq 173 aa AA seqDB search
MIMKMTHLNMKDFNKPNEPFVVFGRMIPAFENGVWTYTEERFSKPYFKQYEDDDMDVSYV
EEEGKAAFLYYLENNCIGRIKIRSNWNGYALIEDIAVAKDYRKKGVGTALLHKAIEWAKE
NHFCGLMLETQDINISACHFYAKHHFIIGAVDTMLYSNFPTANEIAIFWYYKF
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgaaaatgactcatttgaatatgaaagatttcaataaaccaaacgaacctttc
gttgtttttgggagaatgatacctgcttttgaaaacggtgtttggacatatactgaggaa
cgattttctaaaccttattttaaacaatatgaagatgatgacatggatgttagttatgtt
gaagaagaggggaaagcggcttttttatattatcttgaaaacaactgcattggccggatt
aagatccgttctaactggaatgggtatgcactaatagaggacattgccgtggcaaaagac
tatagaaaaaaaggtgttggaacagcattattacataaagcgattgagtgggcaaaggag
aatcatttttgtggtcttatgcttgaaacccaagatattaatatttcagcttgtcatttt
tatgccaaacatcactttataataggtgcggttgatacgatgctttattccaactttcca
acagcaaatgaaattgcgattttttggtactataaattttaa

DBGET integrated database retrieval system