KEGG   Bacillus subtilis subsp. subtilis 168: BSU40740
Entry
BSU40740          CDS       T00010                                 

Symbol
yyaR
Name
(RefSeq) hypothetical protein
  KO
K19273  streptothricin acetyltransferase [EC:2.3.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bsu01504]
    BSU40740 (yyaR)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.-  Acyltransferases
    2.3.-.-  
     BSU40740 (yyaR)
Antimicrobial resistance genes [BR:bsu01504]
 Gene variants
  Aminoglycoside resistance genes
   Other acetyltransferases
    BSU40740 (yyaR)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_9 Acetyltransf_CG Acetyltransf_3 Acetyltransf_13
Other DBs
NCBI-GeneID: 937878
NCBI-ProteinID: NP_391954
Pasteur: BG10033
BSORF: BG10033
UniProt: P37506 A0A6M4JRB2
Position
complement(4185160..4185681)
AA seq 173 aa
MIMKMTHLNMKDFNKPNEPFVVFGRMIPAFENGVWTYTEERFSKPYFKQYEDDDMDVSYV
EEEGKAAFLYYLENNCIGRIKIRSNWNGYALIEDIAVAKDYRKKGVGTALLHKAIEWAKE
NHFCGLMLETQDINISACHFYAKHHFIIGAVDTMLYSNFPTANEIAIFWYYKF
NT seq 522 nt   +upstreamnt  +downstreamnt
atgatcatgaaaatgactcatttgaatatgaaagatttcaataaaccaaacgaacctttc
gttgtttttgggagaatgatacctgcttttgaaaacggtgtttggacatatactgaggaa
cgattttctaaaccttattttaaacaatatgaagatgatgacatggatgttagttatgtt
gaagaagaggggaaagcggcttttttatattatcttgaaaacaactgcattggccggatt
aagatccgttctaactggaatgggtatgcactaatagaggacattgccgtggcaaaagac
tatagaaaaaaaggtgttggaacagcattattacataaagcgattgagtgggcaaaggag
aatcatttttgtggtcttatgcttgaaacccaagatattaatatttcagcttgtcatttt
tatgccaaacatcactttataataggtgcggttgatacgatgctttattccaactttcca
acagcaaatgaaattgcgattttttggtactataaattttaa

DBGET integrated database retrieval system