KEGG   Bacillus subtilis subsp. subtilis 168: BSU40750Help
Entry
BSU40750          CDS       T00010                                 

Gene name
yyaQ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YjbR
Motif
Other DBs
NCBI-GeneID: 937883
NCBI-ProteinID: NP_391955
Pasteur: BG10034
BSORF: BG10034
UniProt: P37507
Position
4186092..4186448
Genome map
AA seq 118 aa AA seqDB search
MLTREDIFKHVKEKYGTSPDYPWEKYPNYASLRHTSNKKWYGLIMNVLPEKLGLDGHGEI
DILNLKCPPEISDRLRNGENILPGYHMDKEHWISIVLERTDPEGEIYNLIEQSFHLTK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgttaacaagagaagatatctttaaacacgtcaaagaaaaatacggtacatcgcctgat
tacccgtgggagaaatacccaaactatgcttctttgagacatacatcaaacaaaaaatgg
tacggtcttatcatgaatgttctcccagaaaaattaggcttggatggtcatggcgaaata
gatattctaaatctaaaatgtccccctgaaataagtgatcgcttaagaaacggggaaaat
atcttacccggatatcatatggataaggaacattggatttcaattgttttagaacggaca
gatccagaaggcgaaatctataacttaatcgagcagagctttcatttaaccaagtga

DBGET integrated database retrieval system