KEGG   Bacillus subtilis subsp. subtilis 168: BSU40770Help
Entry
BSU40770          CDS       T00010                                 

Gene name
tetB
Definition
(RefSeq) tetracycline resistance protein
  KO
K08168  MFS transporter, DHA2 family, metal-tetracycline-proton antiporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU40770 (tetB)
   01504 Antimicrobial resistance genes [BR:bsu01504]
    BSU40770 (tetB)
Transporters [BR:bsu02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-2 (14 spanner) (DHA2) family [TC:2.A.1.3]
    BSU40770 (tetB)
Antimicrobial resistance genes [BR:bsu01504]
 Gene variants
  Tetracycline resistance genes
   Transporters
    BSU40770 (tetB)
 Gene sets
  Vancomycin resistance modules
   Tetracycline resistance, efflux pump Tet38 [MD:M00704]
    BSU40770 (tetB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 OATP DUF624
Motif
Other DBs
NCBI-GeneID: 937890
NCBI-ProteinID: NP_391957
Pasteur: BG10036
BSORF: BG10036
UniProt: P23054
Position
complement(4187681..4189057)
Genome map
AA seq 458 aa AA seqDB search
MNTSYSQSTLRHNQVLIWLCVLSFFSVLNEMVLNVSLPDIANEFNKLPASANWVNTAFML
TFSIGTALYGKLSDQLGIKNLLLFGIMVNGLGSIIGFVGHSFFPILILARFIQGIGAAAF
PALVMVVVARYIPKENRGKAFGLIGSLVAMGEGVGPAIGGMVAHYIHWSYLLLIPTATII
TVPFLIKLLKKEERIRGHIDMAGIILMSAGIVFFMLFTTSYRFSFLIISILAFFIFVQHI
RKAQDPFVDPELGKNVFFVIGTLCGGLIFGTVAGFVSMVPYMMKDVHHLSTAAIGSGIIF
PGTMSVIIFGYIGGLLVDRKGSLYVLTIGSALLSSGFLIAAFFIDAAPWIMTIIVIFVFG
GLSFTKTVISTVVSSSLKEKEAGAGMSLLNFTSFLSEGTGIAIVGGLLSIGFLDHRLLPI
DVDHSTYLYSNMLILFAGIIVICWLVILNVYKRSRRHG
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacgtcttattcacagtcaactttacggcacaatcaagttttgatttggctttgt
gttctatcatttttcagcgtattaaatgaaatggttctgaacgtctcattacctgatatt
gccaacgagtttaataaactgccagcaagtgcaaactgggtgaatacagcctttatgtta
accttctccattggaacagctctatatggaaagctatcagaccagctgggcatcaaaaat
ctgcttctatttgggattatggtaaatggcttagggtcgatcattggatttgttggacac
tctttctttcctattctcattctagcccgatttattcaaggaattggtgcagccgcattc
ccagctcttgtgatggttgtcgttgcgcgctatattccaaaagagaacagggggaaagca
tttggcctgatcgggtccctggtagcaatgggagaaggtgttgggccagctattggcgga
atggttgctcattatatccattggtcgtatttgctgcttattccaactgcaacaattatc
accgttccattccttataaaattgttgaaaaaggaagagagaataagaggacacattgat
atggcagggattatattgatgtctgcaggtatcgtattttttatgctgtttacaacatct
tatagattttcttttctgatcatcagtatccttgctttcttcatatttgtgcaacacatt
aggaaagctcaggacccttttgttgaccctgaattagggaaaaacgtcttttttgtgatt
ggaaccctttgcggaggactaatatttggtacagtagcaggatttgtctctatggttcct
tacatgatgaaagatgttcaccatttaagtactgcagcaattggaagcggcattattttc
cccggaacaatgagtgtcatcatctttggttacattgggggattgcttgttgatcggaaa
ggttccttgtatgtactaactattggaagtgcattgctttcttccggctttttaatcgct
gccttttttatagatgcagcaccatggatcatgacaattatagtaatttttgtttttggg
gggctatctttcacaaaaacagttatatctacagttgtgtctagcagtttgaaagaaaag
gaagcgggcgctggaatgagtttgcttaatttcacgagctttttatcagagggaacgggt
attgcgattgtaggcggtttattatctatcggcttcctagatcataggctgctgcctatt
gacgttgatcactctacctatttgtatagcaatatgctcatactttttgcaggaatcatt
gttatttgttggctagtaatcttgaatgtatataaacgttcgcggagacatggctaa

DBGET integrated database retrieval system