KEGG   Bacillus subtilis subsp. subtilis 168: BSU40790Help
Entry
BSU40790          CDS       T00010                                 

Gene name
yyaO
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredox_DsbH Thioredoxin_7
Motif
Other DBs
NCBI-GeneID: 937882
NCBI-ProteinID: NP_391959
Pasteur: BG10037
BSORF: BG10037
UniProt: P37509
Position
4189406..4189645
Genome map
AA seq 79 aa AA seqDB search
MPNKSKPNRLIAEKSPYLLQHAHNPVDWFPWGEEAFAKAKRENKPVLVSIGYSTTCHWWP
GIIKSCGTPLKDNRSHFKR
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgccaaataaaagtaaacccaatagattaatcgctgaaaagtctccttatttactccaa
cacgcccacaaccctgtggactggttcccgtggggagaagaagcatttgcaaaagcaaaa
cgcgaaaacaagccggttctggtcagcatcggttattcgacgacttgtcattggtggcct
gggataatcaaatcgtgtggaactccattaaaagataacagaagccattttaaacgataa

DBGET integrated database retrieval system