KEGG   Bacillus subtilis subsp. subtilis 168: BSU40800Help
Entry
BSU40800          CDS       T00010                                 

Gene name
yyaN
Definition
(RefSeq) HTH-type transcriptional regulator YyaN
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MerR_1 MerR MerR-DNA-bind DASH_Spc19 DASH_Duo1 Phytochelatin
Motif
Other DBs
NCBI-GeneID: 937892
NCBI-ProteinID: NP_391960
Pasteur: BG10038
BSORF: BG10038
UniProt: P37510
Position
4189796..4190212
Genome map
AA seq 138 aa AA seqDB search
MLLYSISKAAEKTSISSYTLRYYEKIGLLPPPKRKNSGRRFYTETDIQFMLFLKSLKETG
MSLEDINEFVKDGCILEKINSDVKSAQLSPSINKRIEILTKHLEKMEIKKRELEEVISTT
KGKLDTYYSILKEEVENK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgttgttgtattccattagtaaagctgctgagaagactagtattagttcgtatacatta
agatattacgaaaagattgggttacttccaccaccaaaacgaaaaaacagtggaaggcgt
ttttatacggagactgatattcagttcatgttattcctgaaaagtttaaaggaaacaggt
atgtctttggaggatattaatgagtttgtcaaagacggatgcattttggaaaaaatcaat
tcggatgttaaatcggcacaactctccccatctataaataaacgtattgagattttaacc
aagcacttagagaaaatggaaattaaaaaaagggagctggaagaagtgatttctactaca
aaaggaaaactggatacatattattcaattttgaaagaggaagtggaaaacaaatga

DBGET integrated database retrieval system