KEGG   Bacillus subtilis subsp. subtilis 168: BSU40810Help
Entry
BSU40810          CDS       T00010                                 

Gene name
yyaM
Definition
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA TMEM234
Motif
Other DBs
NCBI-GeneID: 937895
NCBI-ProteinID: NP_391961
Pasteur: BG10039
BSORF: BG10039
UniProt: P37511
Position
4190209..4191126
Genome map
AA seq 305 aa AA seqDB search
MKHLNIYIMLLGFSIFTGATFNLAKYTVGYFSPSSSAAWRFGLAAAVMLIILIFTEGIKK
SQLRKNAVSYIVLGIIGIFGFNALFFVGLKYTSPVNGALIMGLNPLLTAILARIILKDNM
TKKQVLGIFFAFIGVLLVITQGSIETIKTLSISGGDLIIFTGNVCWALYGVLGRRFVKDG
TPLSTTTYTMVIGAVSLIVVSLFTSKPVSLSNIPIGVWGAIAFMAFFTSVLGYLWWNQGI
KEIGASKTSLFFNLVPVVTMIISFAVGTPIKVFQVIGAVLVILGVLTASGVIRIPKYNTK
EQSAI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatttaaatatatacataatgttacttggcttctctattttcacgggagctact
tttaatcttgcaaaatatacagttggatatttttctccatcgtcttctgcggcatggcgt
ttcggtttagcggctgcagtgatgctcatcattttgatttttactgaaggtataaagaag
agtcaattacggaaaaacgccgtttcatacattgttcttggaattataggaatctttgga
tttaatgccttgttttttgttggtttaaaatatacatctcccgttaacggagcattaata
atggggctgaatcctttattaacagcaattctcgctcgaattatcttaaaggacaacatg
acaaaaaaacaagtactcggcatattctttgcattcatcggtgtattgttagtcattaca
caaggttctatcgaaaccattaaaaccttatcaatttcaggaggagacttaataatcttt
acaggtaacgtttgttgggcactttatggcgtacttggacgtcggtttgtaaaggatggt
acaccgctatctacaaccacttatacgatggttattggtgctgttagtttaatagtagtt
tccttatttacatccaaacctgtttctttatcgaacatcccgattggagtttggggggca
attgcttttatggctttttttacaagtgttttgggttacctatggtggaatcaggggatt
aaagagattggagctagtaaaacatctttatttttcaaccttgttcccgttgtaacgatg
attatttcatttgccgttggaacaccaataaaggtatttcaagttattggggctgtgcta
gttatattaggcgttttaaccgcttcgggggtaatacgtattcctaagtacaatactaaa
gaacagtcagctatataa

DBGET integrated database retrieval system