KEGG   Bacillus subtilis subsp. subtilis 168: BSU40830Help
Entry
BSU40830          CDS       T00010                                 

Gene name
yyaK
Definition
(RefSeq) hypothetical protein
  KO
K07052  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU40830 (yyaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPBP
Motif
Other DBs
NCBI-GeneID: 937893
NCBI-ProteinID: NP_391963
Pasteur: BG10041
BSORF: BG10041
UniProt: P37513
Position
complement(4193264..4194163)
Genome map
AA seq 299 aa AA seqDB search
MNSFIRPIEGNNTLWRYFFAFLVMVGLYVLGNIAYLFAILFTVIVNPNITFDLDEAVLSD
PLVDLYLSHVIYLFAIPGVWLAVRFILKRPFRTVITPNSKMNWRRISFGFIAYFLLMIAV
QLIDFVIHPDSYSMQEFNASRFIWLLAAALILVPIQTSAEELFFRGFLLQAFGRLTKNPL
FLTLIVGGLFGVLHFANPEMNNGAVWAGIEYLTFGFVWTYYTIKTGSIEISLGAHAANNM
FLCMFITEKNSVYGGIPSLFTVTRGNPMWEAFFTIAVNLVFAGIALWYHKKSKSKQQGS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaattcatttatccgtcctatagaaggaaacaatacgttgtggagatattttttcgct
tttttggtgatggtagggttatatgtattagggaatatagcttaccttttcgctatattg
ttcacggttattgtgaatcccaatatcacgtttgatttggatgaagctgtgctgagtgat
cccctcgtagatctttatttgtcccatgtgatttatttattcgccattccgggagtttgg
ctggctgtgcgctttattttgaagcggcctttccgaacggtgataacaccaaattcaaag
atgaattggcggagaatttcctttggttttattgcttatttcttgctaatgatcgccgta
caattgattgattttgtgattcatcctgatagctattcaatgcaagagtttaatgcatca
cgatttatctggctgctagcggctgccctcattttggttccgattcagacatcagctgag
gaactatttttcaggggatttttgcttcaagctttcgggagattgacgaaaaatcctcta
tttttgacactgattgtcggaggattgtttggcgtattgcattttgcgaatccagaaatg
aacaatggcgctgtctgggcaggaattgagtacttaacatttgggtttgtgtggacgtat
tacacgattaaaactgggagcatcgaaatatcacttggcgcccatgccgcgaataatatg
tttttgtgtatgtttattacagaaaaaaacagtgtgtatggaggaattccttctctgttt
accgttacgcgggggaacccgatgtgggaggctttctttacgatagcggtcaaccttgtg
tttgcggggatcgctttatggtaccataagaaatcaaaaagtaagcagcaagggtcttaa

DBGET integrated database retrieval system