KEGG   Bacillus subtilis subsp. subtilis 168: BSU40830
Entry
BSU40830          CDS       T00010                                 

Symbol
yyaK
Name
(RefSeq) hypothetical protein
  KO
K07052  CAAX protease family protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU40830 (yyaK)
Peptidases and inhibitors [BR:bsu01002]
 Glutamic peptidases
  Family G5: prenyl protease 2 family
   BSU40830 (yyaK)
SSDB
Motif
Pfam: Rce1-like
Other DBs
NCBI-GeneID: 937893
NCBI-ProteinID: NP_391963
Pasteur: BG10041
BSORF: BG10041
UniProt: P37513 A0A6M3ZIP3
Position
complement(4193264..4194163)
AA seq 299 aa
MNSFIRPIEGNNTLWRYFFAFLVMVGLYVLGNIAYLFAILFTVIVNPNITFDLDEAVLSD
PLVDLYLSHVIYLFAIPGVWLAVRFILKRPFRTVITPNSKMNWRRISFGFIAYFLLMIAV
QLIDFVIHPDSYSMQEFNASRFIWLLAAALILVPIQTSAEELFFRGFLLQAFGRLTKNPL
FLTLIVGGLFGVLHFANPEMNNGAVWAGIEYLTFGFVWTYYTIKTGSIEISLGAHAANNM
FLCMFITEKNSVYGGIPSLFTVTRGNPMWEAFFTIAVNLVFAGIALWYHKKSKSKQQGS
NT seq 900 nt   +upstreamnt  +downstreamnt
atgaattcatttatccgtcctatagaaggaaacaatacgttgtggagatattttttcgct
tttttggtgatggtagggttatatgtattagggaatatagcttaccttttcgctatattg
ttcacggttattgtgaatcccaatatcacgtttgatttggatgaagctgtgctgagtgat
cccctcgtagatctttatttgtcccatgtgatttatttattcgccattccgggagtttgg
ctggctgtgcgctttattttgaagcggcctttccgaacggtgataacaccaaattcaaag
atgaattggcggagaatttcctttggttttattgcttatttcttgctaatgatcgccgta
caattgattgattttgtgattcatcctgatagctattcaatgcaagagtttaatgcatca
cgatttatctggctgctagcggctgccctcattttggttccgattcagacatcagctgag
gaactatttttcaggggatttttgcttcaagctttcgggagattgacgaaaaatcctcta
tttttgacactgattgtcggaggattgtttggcgtattgcattttgcgaatccagaaatg
aacaatggcgctgtctgggcaggaattgagtacttaacatttgggtttgtgtggacgtat
tacacgattaaaactgggagcatcgaaatatcacttggcgcccatgccgcgaataatatg
tttttgtgtatgtttattacagaaaaaaacagtgtgtatggaggaattccttctctgttt
accgttacgcgggggaacccgatgtgggaggctttctttacgatagcggtcaaccttgtg
tttgcggggatcgctttatggtaccataagaaatcaaaaagtaagcagcaagggtcttaa

DBGET integrated database retrieval system