KEGG   Bacillus subtilis subsp. subtilis 168: BSU40840Help
Entry
BSU40840          CDS       T00010                                 

Gene name
yyaJ
Definition
(RefSeq) metabolite transport protein YyaJ
  KO
K08369  MFS transporter, putative metabolite:H+ symporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU40840 (yyaJ)
Transporters [BR:bsu02000]
 Major Facilitator Superfamily (MFS)
  Unknown transporters
   Others
    BSU40840 (yyaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_4 MFS_1_like Zip
Motif
Other DBs
NCBI-GeneID: 937884
NCBI-ProteinID: NP_391964
Pasteur: BG10042
BSORF: BG10042
UniProt: P37514
Position
4194389..4195744
Genome map
AA seq 451 aa AA seqDB search
MNTIFKQKNTHPFSNAANRLDRLPISRVHFQVLTALGIVYFFDLADLFTLSNVAPALIEH
WGIPLSTIANVTAASFLGMFLGASLGGRLSDRIGRKKALNLFVFVFSIASLCNAAAWDIP
SLMTFRFLTGFGVAAAMVITNSYLAEFFPSSVRGKYISFCAMIGLIGVPITNIVSAFVIP
LGSWGWRLVFVWGAVGLIYFFFIHRLEESPRWHENRGEYAKADAILTRIEEQVEKEKGPL
PAASQPKVSETVKQNAGYAGLLKGRNLKITIVLSAVWIFETFGFYGFASWVPSLLKSNGV
TMENTLWYNVLHSVGAPLGALLGSMISERFQRKWILAASAFLTAIAGLLYGMTFIPIMII
VFGFIVNITERVFTSNLYAYTSEPYPTEYRSSGSGLAYGLGRFSNIFGSLLVGFIAVQLG
YISVFLFIGGCWLACSLLLIFFGPNTNAKQI
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgatcttcaaacaaaagaatacacatcctttctcaaacgcagcgaatcgttta
gaccgccttccgatttcacgcgttcatttccaagtgttaaccgctctcggcattgtttat
ttctttgatctcgcagatttatttaccctcagcaacgtagcgccggcactgatcgagcat
tggggcatcccgctttcaactattgctaacgtaacggccgcttcgtttttaggcatgttt
ttaggcgcttcactgggcggacggctgtccgatcgaatcggccgcaaaaaagccttaaat
ctatttgtctttgttttctcaatcgcatcgctatgcaatgctgcggcatgggacattcca
tctttaatgacattccgtttcctcaccggatttggcgttgcagccgccatggtcattacg
aatagctatttggcggaatttttcccttcaagtgtacgtggaaaatatatttctttttgt
gccatgattggattgattggggttccgatcaccaacattgtgtctgcctttgtcattcct
cttggttcatggggatggaggctagtatttgtatggggtgccgtcggccttatttatttt
ttcttcatccaccgtctggaagagtcacctcgctggcacgaaaatcgcggggaatatgcg
aaagccgatgcgatcctcacccgaattgaagaacaggttgaaaaggagaaaggcccgctt
ccggcagcatcccagcctaaagtaagcgaaactgttaagcagaatgcaggttacgcaggc
ttattgaaaggcagaaacctcaaaattaccatcgtattatctgctgtatggatttttgaa
acgtttgggttttacggatttgcttcatgggttccaagcctgctaaaaagcaatggcgta
accatggaaaatacattatggtataacgtattgcattccgtcggcgctccacttggcgca
ctgctcggctccatgatttccgaaagatttcaaagaaaatggattttagctgcgagtgcg
tttctgacggccatcgccgggctcttatatggtatgacttttattcccatcatgatcatt
gtatttggttttatcgtgaatatcacagaacgggtctttacctcgaacttatacgcctat
acatctgaaccttatccgactgaataccgctcgtctggcagcggtttagcctatggtctt
ggccgtttttcaaacatttttggctcattgcttgtcggatttattgccgttcagctcggc
tatatcagcgtcttcttatttattgggggctgttggctcgcatgctccttgctgttaatc
ttcttcggtcctaatacgaatgcaaaacagatttaa

DBGET integrated database retrieval system