KEGG   Bacillus subtilis subsp. subtilis 168: BSU40850Help
Entry
BSU40850          CDS       T00010                                 

Gene name
maa
Definition
(RefSeq) maltose O-acetyltransferase
  KO
K00661  maltose O-acetyltransferase [EC:2.3.1.79]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU40850 (maa)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.79  maltose O-acetyltransferase
     BSU40850 (maa)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mac Hexapep Hexapep_2 UxaC
Motif
Other DBs
NCBI-GeneID: 937913
NCBI-ProteinID: NP_391965
Pasteur: BG10043
BSORF: BG10043
UniProt: P37515
Position
complement(4195778..4196332)
Genome map
AA seq 184 aa AA seqDB search
MLRTEKEKMAAGELYNSEDQQLLLERKHARQLIRQYNETPEDDAVRTKLLKELLGSVGDQ
VTILPTFRCDYGYHIHIGDHTFVNFDCVILDVCEVRIGCHCLIAPGVHIYTAGHPLDPIE
RKSGKEFGKPVTIGDQVWIGGRAVINPGVTIGDNAVIASGSVVTKDVPANTVVGGNPARI
LKQL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggacagaaaaagaaaaaatggcagccggagaattatacaattcggaagatcaa
caactattactagaacgcaagcatgcgagacagctgattagacaatacaacgaaacaccg
gaagatgatgcagtgcggacgaagcttttgaaggagctgctcggttcggttggggatcaa
gtcacgattttgccgacattccgctgtgattatggctatcacattcatatcggagatcat
acatttgttaattttgactgtgtcattttagatgtgtgtgaggtgcgtatcggctgtcat
tgtttgattgcgccaggtgtacatatctacacggccggtcatcctcttgatccgatcgaa
aggaaatccgggaaggagttcggtaagcctgtgacaattggagatcaagtttggattgga
ggccgggcggtgattaacccgggagtgacaatcggtgataacgcagtgattgcttctgga
tctgttgtcactaaggatgtacccgctaatactgttgtaggcggaaaccccgcaaggatt
ttgaagcaattgtaa

DBGET integrated database retrieval system