KEGG   Bacillus subtilis subsp. subtilis 168: BSU40860Help
Entry
BSU40860          CDS       T00010                                 

Gene name
yyaH
Definition
(RefSeq) hypothetical protein
  KO
K01759  lactoylglutathione lyase [EC:4.4.1.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00620  Pyruvate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSU40860 (yyaH)
Enzymes [BR:bsu01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.5  lactoylglutathione lyase
     BSU40860 (yyaH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_4
Motif
Other DBs
NCBI-GeneID: 937879
NCBI-ProteinID: NP_391966
Pasteur: BG10044
BSORF: BG10044
UniProt: P37516
Position
complement(4196350..4196730)
Genome map
AA seq 126 aa AA seqDB search
MQIEHTAVWVNDLERMKSFYESYFNGEANDLYHNEKKDFKSYFITFDSGARLEIMKKGNV
TDPPSQTMTGWAHIAFSVGSREKVDELTDRLKADGFAVVNGPRTTGDGYYESVIEDDEGN
LIEITI
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcagattgaacatacagcggtctgggtcaatgatttagagcgaatgaagtctttttat
gaatcgtattttaatggcgaagcgaatgatttgtatcataatgagaaaaaagattttaag
tcttattttattacgtttgattccggagcaaggctggaaattatgaaaaaagggaatgtg
accgatccgccctcacaaacaatgacaggctgggcacatattgccttttccgttgggagc
cgggagaaagttgacgaactgactgatcgattgaaggcggatggtttcgcagtagtaaac
ggcccgaggacaacaggagacggctactatgaaagcgtgattgaggatgatgaaggaaat
ttgatcgagattacaatctga

DBGET integrated database retrieval system