KEGG   Bacillus subtilis subsp. subtilis 168: BSU40870Help
Entry
BSU40870          CDS       T00010                                 

Gene name
ccpB
Definition
(RefSeq) catabolite control protein B
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_1 LacI Peripla_BP_3 HTH_Tnp_ISL3 Peripla_BP_4 HTH_38 HTH_23 HTH_7 MarR
Motif
Other DBs
NCBI-GeneID: 937876
NCBI-ProteinID: NP_391967
Pasteur: BG10045
BSORF: BG10045
UniProt: P37517
Position
complement(4196786..4197721)
Genome map
AA seq 311 aa AA seqDB search
MANIKEIARLANVSVSTVSRVLNHHPYVSEEKRKLVHQVMKELDYTPNRTAIDLIRGKTH
TVGVILPYSDHPCFDKIVNGITKAAFQHEYATTLLPTNYNPDIEIKYLELLRTKKIDGLI
ITSRANHWDSILAYQEYGPVIACEDTGDIDVPCAFNDRKTAYAESFRYLKSRGHENIAFT
CVREADRSPSTADKAAAYKAVCGRLEDRHMLSGCNDMNDGELAAEHFYMSGRVPTAIYAN
SDEVAAGIHLFAKKNNWDVEIIGEGNTSISRVLGFPSLDLNLEQLGIAAFSLFLQDEPAD
IKIQHKFKKKA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatataaaagagatcgcaagactggcaaatgtatctgtttcgactgtctcgcgt
gtattgaatcatcatccgtatgtatctgaagaaaagagaaagcttgttcatcaagtcatg
aaggaattggattatacaccaaatcgaaccgcaatcgatctcattcgcgggaaaacccat
acggtcggtgtgattctgccttatagcgatcatccctgctttgataaaatcgttaacgga
atcaccaaggcggcttttcagcatgagtatgcaacgacccttctccccaccaattataac
cccgatattgaaatcaaatatttagagctgttaagaacgaagaaaatagacggtctcatc
attacttcccgcgccaatcattgggacagcattttagcttatcaggaatatgggccggtc
atcgcttgtgaggataccggagacattgatgtcccttgtgcttttaatgacagaaaaact
gcttatgcagagagctttcgctatttaaagagccgcgggcatgagaatattgcttttacg
tgtgtcagagaagctgataggagcccgagcacggctgataaagctgcggcctataaagct
gtctgcggaaggttggaagaccgccatatgctgtccggatgcaacgatatgaatgatggt
gagctggcagctgaacatttttatatgagcgggcgggttccgactgctatttatgcaaat
agtgatgaagtggcagctggaattcatctatttgccaaaaagaataattgggatgttgaa
atcataggcgagggaaatacttctatcagccgtgttcttggttttccgtcgcttgatttg
aatcttgagcagctcggcatcgcagcattttctctatttttgcaggatgaacccgctgat
atcaaaattcagcataaatttaagaaaaaagcttga

DBGET integrated database retrieval system