KEGG   Bacillus subtilis subsp. subtilis 168: BSU40880Help
Entry
BSU40880          CDS       T00010                                 

Gene name
exoAA
Definition
(RefSeq) exodeoxyribonuclease
  KO
K01142  exodeoxyribonuclease III [EC:3.1.11.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BSU40880 (exoAA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU40880 (exoAA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     BSU40880 (exoAA)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     BSU40880 (exoAA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exo_endo_phos Exo_endo_phos_2
Motif
Other DBs
NCBI-GeneID: 937918
NCBI-ProteinID: NP_391968
Pasteur: BG10046
BSORF: BG10046
UniProt: P37454
Structure
PDB: 

Position
complement(4197780..4198538)
Genome map
AA seq 252 aa AA seqDB search
MKLISWNVNGLRAVMRKMDFLSYLKEEDADIICLQETKIQDGQVDLQPEDYHVYWNYAVK
KGYSGTAVFSKQEPLQVIYGIGVEEHDQEGRVITLEFENVFVMTVYTPNSRRGLERIDYR
MQWEEALLSYILELDQKKPVILCGDLNVAHQEIDLKNPKANRNNAGFSDQEREAFTRFLE
AGFVDSFRHVYPDLEGAYSWWSYRAGARDRNIGWRIDYFVVSESLKEQIEDASISADVMG
SDHCPVELIINI
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgatttcatggaatgtaaacggcctgcgggctgtgatgagaaaaatggatttc
ctctcttatttgaaagaagaggatgcagatattatatgtcttcaggaaacgaagatacag
gacggccaggttgatctccagcctgaagactatcatgtgtactggaattatgcagtgaaa
aaaggatattccggcacagctgttttttctaagcaagaaccgctgcaggtcatctacggt
atcggagtagaagagcatgaccaagaaggcagagtgattacgctggaatttgaaaacgtg
tttgtgatgactgtttacacgcccaattccagaaggggattagagcggattgattaccgc
atgcaatgggaagaggctttactgtcttatattcttgaattggatcagaaaaaaccagtg
attttatgcggtgatttgaatgtagcccatcaggagattgacttgaaaaatccaaaggcg
aaccggaataacgctggattttcagatcaagaaagagaggcattcactcgtttcttagaa
gctggctttgttgattcttttcgtcatgtttatcctgatcttgaaggcgcttattcctgg
tggtcgtatcgtgccggcgcccgggacagaaatattggatggcggattgattattttgtt
gtttctgaaagccttaaggaacagattgaagatgccagcatatcagcggacgtcatgggt
tccgaccattgtcctgttgaacttatcatcaatatatga

DBGET integrated database retrieval system