KEGG   Bacillus subtilis subsp. subtilis 168: BSU40890Help
Entry
BSU40890          CDS       T00010                                 

Gene name
rpsR
Definition
(RefSeq) 30S ribosomal protein S18
  KO
K02963  small subunit ribosomal protein S18
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Module
bsu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU40890 (rpsR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU40890 (rpsR)
Ribosome [BR:bsu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    BSU40890 (rpsR)
  Bacteria
    BSU40890 (rpsR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S18
Motif
Other DBs
NCBI-GeneID: 937906
NCBI-ProteinID: NP_391969
Pasteur: BG10047
BSORF: BG10047
UniProt: P21475
Position
complement(4198603..4198842)
Genome map
AA seq 79 aa AA seqDB search
MAGGRRGGRAKRRKVCYFTSNGITHIDYKDVDLLKKFVSERGKILPRRVTGTNAKYQRKL
TAAIKRARQMALLPYVSGE
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaggacgcagaggcggtcgtgcgaaacgccgtaaagtgtgttatttcacttct
aacggtatcacgcacatcgactacaaagatgtagatcttcttaaaaagtttgtttctgag
cgcggtaaaattttaccacgtcgtgtaactggaacaaacgctaaataccaacgtaaattg
actgcagcgatcaaacgcgcacgtcaaatggctttacttccatacgtaagcggtgagtaa

DBGET integrated database retrieval system