KEGG   Bacillus subtilis subsp. subtilis 168: BSU40900Help
Entry
BSU40900          CDS       T00010                                 

Gene name
ssbA
Definition
(RefSeq) single-stranded DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03030  DNA replication
bsu03430  Mismatch repair
bsu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BSU40900 (ssbA)
   03430 Mismatch repair
    BSU40900 (ssbA)
   03440 Homologous recombination
    BSU40900 (ssbA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU40900 (ssbA)
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU40900 (ssbA)
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU40900 (ssbA)
DNA replication proteins [BR:bsu03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    BSU40900 (ssbA)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     BSU40900 (ssbA)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    BSU40900 (ssbA)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    BSU40900 (ssbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSB tRNA_anti-codon ARHGEF5_35
Motif
Other DBs
NCBI-GeneID: 937911
NCBI-ProteinID: NP_391970
Pasteur: BG10048
BSORF: BG10048
UniProt: P37455
Structure
PDB: 

Position
complement(4198886..4199404)
Genome map
AA seq 172 aa AA seqDB search
MLNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFTNQSGEREADFINCVTWRRQAEN
VANFLKKGSLAGVDGRLQTRNYENQQGQRVFVTEVQAESVQFLEPKNGGGSGSGGYNEGN
SGGGQYFGGGQNDNPFGGNQNNQRRNQGNSFNDDPFANDGKPIDISDDDLPF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaccgagttgtattagtcggaagactgacaaaagacccagagcttcgttatacg
ccaaacggtgcggctgttgctacgtttactcttgctgtgaatcgtacatttacgaaccag
tccggagaacgtgaggccgatttcattaattgtgtcacttggagaagacaagccgaaaac
gttgcaaacttcttgaaaaaaggaagccttgcaggcgtagatggccgtttacaaacaaga
aactatgaaaaccagcaaggacagcgtgtcttcgtgacagaggtccaagctgaaagtgtt
caatttcttgagccgaaaaacggcggcggttctggttcaggtggatacaacgaaggaaac
agcggcggaggccagtactttggcggaggccaaaatgataatccatttgggggaaatcaa
aacaaccagagacgcaatcaggggaacagctttaatgatgacccatttgccaacgacggc
aaaccgattgacatctcggatgatgatcttccattctaa

DBGET integrated database retrieval system