KEGG   Bacillus subtilis subsp. subtilis 168: BSU40910Help
Entry
BSU40910          CDS       T00010                                 

Gene name
rpsF
Definition
(RefSeq) 30S ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Module
bsu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU40910 (rpsF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU40910 (rpsF)
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU40910 (rpsF)
Ribosome [BR:bsu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    BSU40910 (rpsF)
  Bacteria
    BSU40910 (rpsF)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BSU40910 (rpsF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S6 AbiJ_NTD3 NAS
Motif
Other DBs
NCBI-GeneID: 937919
NCBI-ProteinID: NP_391971
Pasteur: BG10049
BSORF: BG10049
UniProt: P21468
Position
complement(4199445..4199732)
Genome map
AA seq 95 aa AA seqDB search
MRKYEVMYIIRPNIDEESKKAVIERFNNVLTSNGAEITGTKDWGKRRLAYEINDFRDGFY
QIVNVQSDAAAVQEFDRLAKISDDIIRHIVVKEEE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagtacgaagttatgtacattatccgcccaaacattgacgaagagtctaaaaaa
gcagttatcgagcgtttcaacaacgttctgacttctaacggtgcggagatcactggaaca
aaggattggggtaaacgtcgtcttgcttacgaaatcaacgatttccgcgacggtttctac
caaatcgtaaacgttcaatctgacgctgcggcagttcaagaatttgaccgtctagctaag
atcagtgacgatatcattcgccacattgttgttaaagaagaagaataa

DBGET integrated database retrieval system