KEGG   Bacillus subtilis subsp. subtilis 168: BSU40920Help
Entry
BSU40920          CDS       T00010                                 

Gene name
yyaF
Definition
(RefSeq) GTP-dependent nucleic acid-binding protein EngD
  KO
K06942  ribosome-binding ATPase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU40920 (yyaF)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic Type
  Other maturation factors
   BSU40920 (yyaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YchF-GTPase_C MMR_HSR1 FeoB_N Pox_A51
Motif
Other DBs
NCBI-GeneID: 937916
NCBI-ProteinID: NP_391972
Pasteur: BG10050
BSORF: BG10050
UniProt: P37518
Position
complement(4199843..4200943)
Genome map
AA seq 366 aa AA seqDB search
MALTAGIVGLPNVGKSTLFNAITQAGAESANYPFCTIDPNVGIVEVPDDRLQKLTELVNP
KKTVPTAFEFTDIAGIVKGASKGEGLGNKFLSHIRQVDAICHVVRAFSDDNITHVSGKVD
PIDDIETINLELILADMETVEKRITRVSKLAKQKDKDAVFEFEILSKLKEAFESEKPARS
VEFTEEQQKLVKQLHLLTSKPILYVANVSEDEVADPSGNENVAKIREYAAGENAEVIVVC
AKIESEIAELEGEEKQMFLEELGIQESGLDQLIKASYSLLGLATYFTAGEQEVRAWTFKK
GMKAPECAGIIHSDFERGFIRAETVAYEDLLAGGGMAGAKEAGKVRLEGKEYVVQDGDVI
HFRFNV
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggctttaacagctggaattgttggtttgccgaacgtcggaaaatcaacactatttaac
gcaattacacaggccggtgccgaatcagccaactacccgttctgtacaattgatccgaac
gtgggaattgtagaggtgccggatgatcgtctgcaaaagctgactgagctggtcaacccg
aagaagactgtgccgactgcttttgaattcactgatattgcagggattgtaaagggcgca
tctaaaggagaaggactcggcaacaagttcctatctcatattcgccaagttgacgcgatt
tgccacgttgtccgtgctttttccgatgacaacattacacacgtttccggaaaggttgat
ccgattgatgacattgaaacgatcaaccttgagctgatcctcgctgatatggaaacagtt
gaaaagcggattacacgcgtcagcaagcttgcgaagcaaaaagataaagacgctgtattt
gagtttgagattttatctaaactgaaagaagcgtttgagagtgaaaagcctgctcgatct
gtagaattcactgaagagcagcaaaagcttgtgaagcagctccatttactgacttcgaag
cctattttgtacgtggccaacgtaagtgaagatgaagttgctgatccatctggcaatgaa
aatgtagcgaagattcgcgagtacgctgccggcgaaaacgcagaagttatcgttgtgtgt
gcaaaaatcgaatctgaaatcgctgagcttgaaggcgaagaaaagcaaatgttcttggaa
gagctgggcattcaagaatcaggtcttgatcagctgatcaaagcgtcttactctcttctc
ggcctcgcaacatatttcacagccggagaacaggaagtcagagcttggacattcaaaaaa
ggcatgaaagcccctgagtgtgcaggaattattcatagtgactttgagcggggcttcatt
cgtgctgagacagttgcttatgaggatcttcttgcgggcggcggtatggcaggagctaaa
gaggcaggaaaagtccgccttgaagggaaagaatatgtggtccaagacggagatgttatt
catttccgatttaatgtatag

DBGET integrated database retrieval system