KEGG   Bacillus subtilis subsp. subtilis 168: BSU40930Help
Entry
BSU40930          CDS       T00010                                 

Gene name
yyaE
Definition
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molybdop_Fe4S4 Molydop_binding
Motif
Other DBs
NCBI-GeneID: 937914
NCBI-ProteinID: NP_391973
Pasteur: BG10051
BSORF: BG10051
UniProt: P37519
Position
complement(4201070..4203073)
Genome map
AA seq 667 aa AA seqDB search
MSKVHQSACPLNCWDSCGFLVTVDDGKVTKVDGDPNHPITEGKICGRGRMLETKTNSPDR
LRYPMKKQNGEFVRISWEQALDEIADKLREIKETSETTAVLHSHDYANNGLLKALDQRFF
NGYGGVTEIVGSICWGSGIEAQSWDFGRSYGHGPLDIYNSKHVVVWGRNVSRTNMHLYHH
LQQVKKKGATITVIDPIFNPTAKLADRYISVKPGMDGWLAAAVLKVLIEMGRTDETFISE
HSVGFDDVKELLKTVSLEEFIVKTETSMEELEYLAGLYADGPVSTFMGLGMQRYKNGGGT
IRWIDALVAASGNVGIKGGGANFGNVQIGESFAKTKLTLPELKTTSRSFSMMTQAEEVLT
AADPAIEMIIVTCGNPLTQVPNTNKVRQAFEKVPMTVAIDSIMTDTAELCDYVLPTATVF
EEEDIYYSSMYHHYVQYGKKLVEPQGEAKSDSWIWSELAKRLGFGELFEYSTQEFLEMGL
SSLEAEDVTLERLKEKGHLPLPVKQVPWDDYQFLTPSGKFEFTSSLAEQKGFSGSLQLNV
PEESVFHNEELAGKYPYTLLSIHPQRSNHSQHVPFIEKLQHVQVDISPDIAAGQDLQDGD
EVVIFNDRGSMKGKVKVMKQAHAKTINIDEGMWAAFGGSVNALTNDTNSDNGMGSTLFDC
LVGLKKA
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagtgcatcagtcggcatgtccgctgaattgttgggacagctgcggctttttg
gtgactgttgatgatggaaaggtaacaaaagtggacggagatccaaaccatccgattacg
gaaggtaaaatctgcggccgcggcagaatgcttgagacaaaaacaaattcgcctgatcgg
cttcgctatccaatgaaaaaacaaaatggcgagtttgtgcggatttcttgggagcaggca
cttgatgaaattgccgataaacttcgggaaatcaaggaaacgtcggagacgactgctgtt
ttgcacagccatgattatgcgaataacggtctgttaaaagcgcttgatcagcgttttttt
aatggatatggcggcgtgaccgaaatcgtcggaagcatatgctggggctccggtatcgag
gcgcaaagctgggattttggccgttcgtacggtcacggaccgcttgatatttacaacagc
aagcatgttgttgtgtggggaagaaatgtatcaagaacaaatatgcacttataccatcac
ttgcagcaggtgaaaaagaagggcgccacgattacggtgattgatccgatcttcaacccg
actgctaagcttgccgaccgctatatctctgtaaagcctggaatggacggctggcttgcg
gcagccgttttgaaggttctgattgagatgggaagaacggatgaaacgtttatttctgag
cattctgtcggttttgatgatgtgaaagagcttttgaagaccgtttctctggaagagttt
attgtgaaaacagaaacttctatggaggagctggagtatttggcaggtttgtatgctgat
ggtccggtgtctacttttatggggcttggcatgcagcgatataaaaacggcgggggaacg
attcgttggattgatgcacttgtggcggcaagcggaaatgtcggaattaagggcggcggc
gcgaatttcggaaatgtccagattggtgagagctttgcaaaaacaaagctgacgctgccg
gaattaaaaacaacatcccgttctttttcaatgatgacacaggctgaagaagtgttgacc
gctgctgatcctgcgattgagatgattattgtgacgtgcggaaatccgctgactcaggtg
ccgaatacaaataaggtgagacaagcatttgaaaaggttccaatgacggtcgcgattgat
tccattatgacggataccgcagagctgtgtgattatgttttgccgactgccactgttttt
gaagaagaagatatctactattccagtatgtatcatcattatgttcagtacgggaagaag
cttgtggagccgcagggtgaagcgaaatcggacagctggatctggtcagagcttgcaaaa
cgtcttgggtttggcgagctgtttgaatacagcactcaagaatttttagagatggggctt
tcttcattggaagcagaggatgtgacacttgagcgtttaaaagaaaaaggccacctccct
cttccagtaaaacaggtgccgtgggatgattatcagtttttgacgccgagtggaaaattt
gaatttacttcgtcgctagctgagcaaaaaggatttagcggctcgcttcaattaaatgtg
cccgaagaatctgttttccataatgaggagttagctggaaagtacccttatacgctctta
tccattcatccgcagcgttccaatcattcacagcatgtgccgtttattgaaaagcttcag
cacgttcaggtcgatatttctccagatatagcggctgggcaggatcttcaggatggagac
gaagttgtcatctttaatgaccgcggaagcatgaagggcaaggtgaaagtgatgaagcag
gctcatgcgaagacgattaatatagatgaaggcatgtgggcggcttttggagggtcagtc
aatgcactgacaaatgatacaaattctgataatggaatgggaagtacgctttttgactgt
ttagtaggcttgaaaaaagcataa

DBGET integrated database retrieval system