KEGG   Bacillus subtilis subsp. subtilis 168: BSU40939Help
Entry
BSU40939          CDS       T00010                                 

Gene name
yyzM
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF951
Motif
Other DBs
NCBI-GeneID: 8302952
NCBI-ProteinID: YP_003097803
UniProt: C0H3V8
Position
complement(4203124..4203330)
Genome map
AA seq 68 aa AA seqDB search
MADKDFGLNDIVEMKKPHPCGANSWKIIRMGMDIRIKCEGCSHSVMIPRREFERKLKKVL
VKHEEPTS
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
ttggcggataaagactttggcctgaatgatatcgtagaaatgaaaaaaccgcatccatgc
ggagcgaacagctggaaaattatacgcatgggaatggatattcgaattaagtgtgaggga
tgctctcacagtgttatgattccgagaagagaatttgaaagaaaactaaaaaaagtacta
gtcaagcatgaggagcctacttcataa

DBGET integrated database retrieval system