KEGG   Bacillus subtilis subsp. subtilis 168: BSU40940Help
Entry
BSU40940          CDS       T00010                                 

Gene name
yyaD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_permease Microcin
Motif
Other DBs
NCBI-GeneID: 937923
NCBI-ProteinID: NP_391974
Pasteur: BG10052
BSORF: BG10052
UniProt: P37520
Position
complement(4203424..4204440)
Genome map
AA seq 338 aa AA seqDB search
MLWRAGMKWMLLILGSLIGAGYASGQEIWQFFGAESGLAIVLFTIMFIFSSYIVMKISFK
VQSTHFLPVLEHLMGPWLAKIYDVLIIFYLFSTTMVMIAGGGVTLQMYKLPFWWGITLIC
IVTVCLFLWDVKGILSINSILIPVLVAGLLYALISFQSTHHHTWTIDLSQQYNWPASITF
TSLNILSVVAILSSVGKEMKGLGEAKIASVASGLIFGVISFVYNETLVELAGSLSQFEIP
LFAVLEGAPYFLFLCMTAVLCLAIYTTTVAGLLGLSSRLMAFIHMPRWMIVLILLVLMVP
FTSFGFSDLIAFLYPIYGMLNLYLLVCLLLYPILSKWK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgttgtggagagccggaatgaagtggatgctgctcatattagggagcctgatcggggcc
ggatatgcgagcggtcaggagatatggcagttttttggggcggaaagcggacttgctatt
gtgctgtttacaattatgttcattttctcgtcttatattgtgatgaaaatcagttttaag
gttcaatccactcattttctgccggttctggagcatttaatggggccatggctggcgaaa
atttatgatgtcctcatcattttttatttgttttcgacgactatggtgatgattgccgga
ggcggtgtgaccctgcaaatgtacaagcttcctttctggtggggaatcacgctgatttgc
atcgtgacagtgtgcttgtttttgtgggatgtgaaaggaatattatctataaatagtatt
ttgattcctgtgttagtagcggggcttttatatgcgctgatctcctttcagagcacacat
caccatacgtggacgattgatttgtcccagcagtataactggcctgcgagcattacgttt
acctctttaaacatcctttcagttgttgcgattttatcctctgttgggaaagagatgaaa
gggctcggagaagcaaaaatcgcaagtgtggcaagcggtcttatttttggcgtgatctca
tttgtttataatgaaacgttggtggagctggcgggctccctttctcagtttgaaataccg
ctgtttgccgttctggagggtgcgccttatttcctttttttatgtatgacggcggtgctg
tgcctggcgatttacacgacgacggtagctggtttgctgggtttgtccagccggctgatg
gcgtttattcatatgccgagatggatgattgtgttgattttgttagtgttaatggtacct
tttacttctttcggattttctgatttgatcgcgttcttgtatccgatatatgggatgctc
aatttgtatttgttagtttgtctgctcttatatcctattttgagtaaatggaaataa

DBGET integrated database retrieval system