KEGG   Bacillus subtilis subsp. subtilis 168: BSU40950Help
Entry
BSU40950          CDS       T00010                                 

Gene name
yyaC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1256 Peptidase_A25 DUF169
Motif
Other DBs
NCBI-GeneID: 937925
NCBI-ProteinID: NP_391975
Pasteur: BG10053
BSORF: BG10053
UniProt: P37521
Position
4204900..4205517
Genome map
AA seq 205 aa AA seqDB search
MNRKGGLFSSQERVKQYVSHTDAAAAKQIQTILSSSLRKAAGKPIVVVCIGTDRSTGDSL
GPLVGMKLKQMQLTRFHVYGTLSDPVHAVNMKDKINDIHKLHKNPFVIAVDACLGRVKSV
GSFQIGDGPLKPGAGVQKDLPEVGDLHINGIVNVSGFMEYFVLQNTRLNLVMNMANVLAE
GLSLTDRTEWRQERLNPLQRLTGRI
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgaaaaggcgggcttttttcttctcaggaacgagtaaagcaatatgtttcacat
acagatgctgcagcggcaaaacaaatccaaaccatcctttcttcatccttacgtaaagct
gctggcaaaccaattgtcgtggtttgtatcggaacagaccgttcaaccggtgactcatta
ggcccgctcgtaggaatgaaactcaaacagatgcagctcaccagattccatgtctacgga
accttatctgaccccgtccatgctgtgaacatgaaggataaaatcaatgacattcataaa
ttacataaaaacccatttgttatagcagtcgatgcatgcttaggccgcgttaagagtgtg
ggttcatttcaaatcggggacgggccattaaagcccggagccggtgtacaaaaagacctt
cctgaagtgggagatcttcatattaacggaatcgtgaatgtgagcggttttatggaatat
tttgtattgcaaaatactagactcaacttggtcatgaatatggcaaatgttctagcggaa
ggtttgagtttaacagatcggacagagtggaggcaagaacgccttaacccgttgcaaagg
ctcactgggcgcatataa

DBGET integrated database retrieval system