KEGG   Bacillus subtilis subsp. subtilis 168: BSU40960Help
Entry
BSU40960          CDS       T00010                                 

Gene name
parB
Definition
(RefSeq) stage 0 sporulation protein J
  KO
K03497  ParB family transcriptional regulator, chromosome partitioning protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU40960 (parB)
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU40960 (parB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bsu04812]
    BSU40960 (parB)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BSU40960 (parB)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BSU40960 (parB)
Cytoskeleton proteins [BR:bsu04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   BSU40960 (parB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParBc HTH_ParB KorB HTH_3 HTH_Crp_2 TrmB DUF4974 HTH_37 Sigma70_r4 HTH_19 POTRA_2 MarR_2 HTH_24 MCPVI HTH_29 HTH_5
Motif
Other DBs
NCBI-GeneID: 937907
NCBI-ProteinID: NP_391976
Pasteur: BG10054
BSORF: BG10054
UniProt: P26497
Structure
PDB: 

Position
complement(4205556..4206404)
Genome map
AA seq 282 aa AA seqDB search
MAKGLGKGINALFNQVDLSEETVEEIKIADLRPNPYQPRKHFDDEALAELKESVLQHGIL
QPLIVRKSLKGYDIVAGERRFRAAKLAGLDTVPAIVRELSEALMREIALLENLQREDLSP
LEEAQAYDSLLKHLDLTQEQLAKRLGKSRPHIANHLRLLTLPENIQQLIAEGTLSMGHGR
TLLGLKNKNKLEPLVQKVIAEQLNVRQLEQLIQQLNQNVPRETKKKEPVKDAVLKERESY
LQNYFGTTVNIKRQKKKGKIEIEFFSNEDLDRILELLSERES
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaggccttggaaaagggattaatgcgttatttaatcaggtagatttgtctgaa
gagacagttgaagaaattaaaattgccgatttacgccctaatccttatcagccaagaaaa
cactttgatgacgaggcattagctgaactaaaagaatctgtgctgcagcatggcattctt
cagccgcttatcgtcagaaaatctttaaaaggctatgatattgttgcgggtgaacggcgt
tttcgagcggcaaagctggcaggtttagatacagttccggccattgtccgtgaattatca
gaggcgttaatgagggaaattgctttattagaaaaccttcagcgtgaagatttatctccg
cttgaagaggctcaggcatatgactcccttttgaaacacttagatctcacacaagagcag
cttgccaaacgtcttgggaaaagcagaccgcatattgcgaatcatttaagactgctgaca
ctgccagaaaatattcaacagcttattgccgaaggcacgctttctatgggacatggacgc
acgcttcttggcttaaaaaacaaaaataagcttgaaccgctggtacaaaaagtgattgcg
gagcagctcaatgttcgccaacttgagcagctgattcagcagttgaatcagaatgttcca
cgtgaaacaaagaaaaaagaacctgtgaaagatgcggttctaaaagaacgggaatcctat
ctccaaaattattttggaacaacagttaatattaaaagacagaagaaaaaaggcaaaatc
gaaattgaatttttctctaatgaagaccttgaccggattttagagcttttgtctgaacga
gaatcataa

DBGET integrated database retrieval system