KEGG   Bacillus subtilis subsp. subtilis 168: BSU40970Help
Entry
BSU40970          CDS       T00010                                 

Gene name
parA
Definition
(RefSeq) sporulation initiation inhibitor protein Soj
  KO
K03496  chromosome partitioning protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU40970 (parA)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bsu04812]
    BSU40970 (parA)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BSU40970 (parA)
Cytoskeleton proteins [BR:bsu04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   BSU40970 (parA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_31 CbiA MipZ CBP_BcsQ ParA Fer4_NifH ArsA_ATPase SRP54 VirC1 MeaB FTHFS ATP_bind_1 AAA_24
Motif
Other DBs
NCBI-GeneID: 937928
NCBI-ProteinID: NP_391977
Pasteur: BG10055
BSORF: BG10055
UniProt: P37522
Position
complement(4206397..4207158)
Genome map
AA seq 253 aa AA seqDB search
MGKIIAITNQKGGVGKTTTSVNLGACLAYIGKRVLLVDIDPQGNATSGLGIEKADVEQCV
YDILVDDADVIDIIKATTVENLDVIPATIQLAGAEIELVPTISREVRLKRALEAVKQNYD
YIIIDCPPSLGLLTINALTASDSVVIPVQCEYYALEGLSQLLNTVRLVQKHLNTDLMIEG
VLLTMLDARTNLGIQVIEEVKKYFRDKVYKTVIPRNVRLSEAPSHGKPIILYDPRSRGAE
VYLDLAKEVAANG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaaatcatagcaattacgaaccaaaaaggcggggtcggcaaaacaacgacgtct
gtcaaccttggggcatgtttggcttacatagggaaaagggttctgctggtagatattgat
ccgcagggaaatgcgacaagcggattagggattgaaaaagccgatgtagagcagtgtgtg
tacgatattttagtagatgatgcagatgtaatagatattattaaagcaacgacagtagag
aacttggatgtgattcctgcgacgattcagcttgcaggggctgagatcgagctggttcct
acaatatcaagagaagtgagattgaagagagcgcttgaagcagtaaagcaaaattatgat
tatattatcattgattgtccgccgtcattgggcttgctgacgattaatgcccttactgcc
tcggattccgttgtgattcctgtacagtgcgaatattatgccttggagggtctcagccag
ttattaaatacagtacgtcttgtgcaaaagcatttgaatactgatttaatgattgaaggt
gtattgctgacaatgcttgatgcccggacaaaccttggcattcaagtgattgaagaggtt
aaaaagtattttagggataaagtatataagacagttattccgcgtaatgtccgtctgagt
gaggcaccgagtcacggaaaacccatcattttatacgatccgcggtcaagaggtgcggaa
gtatatttagatttagcaaaggaagtggctgcgaatggctaa

DBGET integrated database retrieval system