KEGG   Bacillus subtilis subsp. subtilis 168: BSU40980
Entry
BSU40980          CDS       T00010                                 

Symbol
yyaB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: bPH_4 bPH_5
Other DBs
NCBI-GeneID: 937929
NCBI-ProteinID: NP_391978
Pasteur: BG10056
BSORF: BG10056
UniProt: P37523 A0A6M3ZI87
Position
4207406..4207846
AA seq 146 aa
MVYQTKRDVPVTLMIVFLILLIQADAIVPFVLGNMRVSGWIIFILLTLLNGLIIWSFIDL
KYVLKEHHLIIKAGLIKHQIPYENIDKVVQKKKLWSGFRLIGSRHAITIYYQGGWGHAVI
SPQKSEEFIHKLKEKNSNIIIFTKSK
NT seq 441 nt   +upstreamnt  +downstreamnt
atggtttatcaaacgaagagagatgtacccgttacgctgatgattgtgtttctcatatta
ctgatacaagcagatgccattgttccttttgtgctgggaaatatgagagtttccggctgg
atcatttttattctgctgactcttttaaatggactcatcatttggagctttattgaccta
aaatatgtattgaaggaacaccatctgatcattaaagccggattgatcaaacatcaaatt
ccttatgaaaacatcgataaagtcgttcaaaaaaagaaactatggtccggttttcgtctg
atcggctctcgccatgccatcacaatatattatcaggggggatggggacatgcagtaatt
tcaccgcaaaaatctgaagaatttatccacaagctcaaagaaaagaattctaatataata
atattcactaaaagtaagtga

DBGET integrated database retrieval system