KEGG   Bacillus subtilis subsp. subtilis 168: BSU40980Help
Entry
BSU40980          CDS       T00010                                 

Gene name
yyaB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: bPH_4 bPH_5
Motif
Other DBs
NCBI-GeneID: 937929
NCBI-ProteinID: NP_391978
Pasteur: BG10056
BSORF: BG10056
UniProt: P37523
Position
4207406..4207846
Genome map
AA seq 146 aa AA seqDB search
MVYQTKRDVPVTLMIVFLILLIQADAIVPFVLGNMRVSGWIIFILLTLLNGLIIWSFIDL
KYVLKEHHLIIKAGLIKHQIPYENIDKVVQKKKLWSGFRLIGSRHAITIYYQGGWGHAVI
SPQKSEEFIHKLKEKNSNIIIFTKSK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggtttatcaaacgaagagagatgtacccgttacgctgatgattgtgtttctcatatta
ctgatacaagcagatgccattgttccttttgtgctgggaaatatgagagtttccggctgg
atcatttttattctgctgactcttttaaatggactcatcatttggagctttattgaccta
aaatatgtattgaaggaacaccatctgatcattaaagccggattgatcaaacatcaaatt
ccttatgaaaacatcgataaagtcgttcaaaaaaagaaactatggtccggttttcgtctg
atcggctctcgccatgccatcacaatatattatcaggggggatggggacatgcagtaatt
tcaccgcaaaaatctgaagaatttatccacaagctcaaagaaaagaattctaatataata
atattcactaaaagtaagtga

DBGET integrated database retrieval system